SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A158NKV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158NKV8
Domain Number 1 Region: 611-737
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.96e-36
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-20
Family PDZ domain 0.0075
Further Details:      
 
Domain Number 3 Region: 925-1004
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-18
Family Ras-binding domain, RBD 0.007
Further Details:      
 
Domain Number 4 Region: 193-302
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000314
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 
Domain Number 5 Region: 869-935
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000248
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A158NKV8
Sequence length 1319
Comment (tr|A0A158NKV8|A0A158NKV8_ATTCE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:XP_012058166.1} KW=Complete proteome; Reference proteome OX=12957 OS=Atta cephalotes (Leafcutter ant). GN=105621313 OC=Vespoidea; Formicidae; Myrmicinae; Atta.
Sequence
MHQNRRKKKRVNYGVRAVEVVRGTKGFGFTISGQQPCILSCIVQGSPAEGAGLRAGDYLV
AVNGHNVSKVPHDDVVQLIGSSKGILRLQIAENYYSDSSDEEGLATVRSKPKYAHKPRTA
STSALQLQCRAAKVVRDLQSGAMFHTDGLAMPDAKDQYNYSGLHYRWNMTSPLPLPPPPA
SHKRDSEKIVHRTVVGYLGTIDIPNQLHPSSMMQVLRKCIKRLKAEKRNPTTVLLTIHVA
NIKLTNSENRIIAEYPSYRIIFCNSFSEQDKQYFGILTKSMRNTDDIVSNSCHVFTIYYK
LIDHEVHSSACNVFGFMCTKSSELNVCQEFPDSCTSLIGAIQTLYISDCTNGENCTNPYN
EARMRLDTASPQPSNISTSTAHSSNSDSGIGFKDDYGSCSSKNLTNDRERRRQYSNMQYR
NVSARLSKEPVNEAAGHRLTVRATSEARLWSEELKFDLSKEMRHVAGSGEGTTTTCAETS
APAATARTMLASTSVGSLASVCTTALLDGIEDVESSKVTSTEGLKRLMDTTNKLSPKVYC
GQITKSLVHSLEDINSSMEYARQPYCHSYSGKSDKPRPWGSLQEIRNFRNSASDNCIYGS
TESCDKNNDCKGVHTWANGFEKLLEDPKGLQTFAEFLKKEFSHENIYFWAACERYKDTKD
TTMRRRLACQIYQRHLSNTAAEPVNVDSHASGQITQELLDEAPADLFLQTQKQVFNLMKF
DSYPRFLRSELYRACLEAGSAVVDTEDCDLHLTSSPSVKLKKSHSDAEDRCRKSLLPWNR
KNRSKSKDRGESEYNKTPSRSETIYKSFTVIKRETEGNNNEDTVSISSSRSSLASWDLAL
RQSFNKHSVSSYDGQMNEKKDARSKCTGLCRVILPDGSTTVVTTSQTESIKDVVTRLLDK
RALRYSNYDVLILATDEMVDTKCFSSVLAGQEVEVVPTKVLKVELPSRRIISIIAHKGKT
LKEILRPLLNKYGFNLDLISIWSEGRCVPMDIMAINAPTRIIVMANEEDFQRELHTAKYL
DEVPHAQPTLDEITNKVFEELLVGKRNKYQYSEGSCKSDDQRSEGSSILSSKFFLRDSTI
HGKKKAKSKCCNTSEKSNTNDCIHEGAPIKSQPPLIAKWRNGVKLQLPGRFDGDELYEGL
KRAQRSRLEDQRGTEINFELPDFLKNKENGKPSDSNKMRRTRVVSANCEGTTKFYDSSED
KQSSSGYEYSAHVTNGAVNERFSALVNITEPLSKCLESSFNLDGDRTLMDGDQTIIENGT
DSPSKSPYSGSYGGTDVSHTKLSKPPPLPPKPKNLVVNVVKSGYVTSPKTLQRPNHVIE
Download sequence
Identical sequences A0A158NKV8
XP_012058166.1.45171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]