SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A161LN87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A161LN87
Domain Number 1 Region: 7-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.97e-79
Family Protein kinases, catalytic subunit 0.0000000299
Further Details:      
 
Domain Number 2 Region: 513-573
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000876
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0082
Further Details:      
 
Domain Number 3 Region: 449-508
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000353
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A161LN87
Sequence length 624
Comment (tr|A0A161LN87|A0A161LN87_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:GAT69055.1} KW=Complete proteome; Reference proteome OX=161355 OS=Planomonospora sphaerica. GN=PS9374_04722 OC=Planomonospora.
Sequence
MTQPRRLGDRYELDGVVGRGGMAEVYRARDIRLDRIVAIKTLRADLARDHTFQARFRREA
QSAASLNHPSIVAVYDTGEDTSEGAPVPYIVMEYVDGSTLRDILRADRRLLPERAAELVD
GILRALDYSHRGGIVHRDIKPANIMITRNGDVKVMDFGIARAMADSAATMTQTAQVIGTA
QYLSPEQARGERVDARSDIYSTGCVLYELLTGQPPFTGDSPVAIAYQHVREDPIPPSQID
PEIPAWADAIVLKAMAKDPAHRYQSAGEMRADIQRALQGMPMDAQTMALANNYGAATRTM
QQQPGPGGPVTQRTTAVPAYEYGTEDGAGRGERGRRRAQGGGNTALKTAAWILIPLLIIG
AFIGVGYTFLSAPGTPTGDGKVEIPALASQTVEAATKQLTDLGLKVKLTHEFNEELPKDA
VIKTDPAAGAKVDKDTEVVVVVSKGVERVTVPDVVGKTVEEATAELEGKGFEVTVVTKAS
SRPQGVVLESDPAAGKKAAKGGTVRIYIPKEAVEVPDVTGYTVGDATKALKDAGFKVKTV
EQPSDQAEGTVLSQSPGSGAKIQPGTTITLTVSSGQPPMPTEEPTPPTDDPSLPSDEPTD
DQPDVPSDEPTDDPFFNSPDGEHG
Download sequence
Identical sequences A0A161LN87
WP_068900145.1.42979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]