SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A167NG32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167NG32
Domain Number 1 Region: 118-414
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.61e-60
Family Pancreatic carboxypeptidases 0.021
Further Details:      
 
Domain Number 2 Region: 659-739
Classification Level Classification E-value
Superfamily PKD domain 0.000000000288
Family PKD domain 0.0094
Further Details:      
 
Domain Number 3 Region: 572-648
Classification Level Classification E-value
Superfamily PKD domain 0.000000275
Family PKD domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A167NG32
Sequence length 740
Comment (tr|A0A167NG32|A0A167NG32_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KZN68202.1} KW=Complete proteome OX=1365248 OS=Pseudoalteromonas luteoviolacea CPMOR-1. GN=N473_07195 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MIKTLIKTSLIATLGALTLPSHSHTHVENNIRAQQPNNLNYSLYFSNEDQRVTYSRQYHG
QIVESLHNALVVSLSEQEFLLARSSGAVILEHTPPKTINRAANELVNANQSILTTTQTSG
IPNFPCYPTLEETYELAEQLAKKYPNFVELKHIGQSWKKEQGLGGHDLTVLVIKNKKRNK
NKKLPTMYMQGALHAREYTAGATTIKFAQHLLENRRTNPDIKWILNQREIHILLIANPDG
RKYAELGKEWRKNTNTAYCATNEEQIGADLNRNFDFAWNSTPYSSDEQCSNTYQGPVAAS
EPETKVIQNYINSIFEDNRGDLDTDAAPLDTAGLFLDIHSFGGMVMWPWSHLRTPPPNSA
GLSMLGHRLAAYSGYVAYQVGNRFHVGGSAGGYAYGQLGVASFTYELGREFFEHCGNFEG
EIFPNTLKSLIYAAKVAKAPYKISGGPQILDYKLEGAGDVAVPPGTPINLTAGIYDDFFG
NQSYTPLPPSQAVKKVKLVIKKQGEGVVQKLKLPAADGIYDSPREQLNYALDTSNWDDGR
YTLILKAQDVTGQWGVKYAKYLTIDDDASAQNKAPVADFIPTCTYGSCQFDASKSTDDKP
GLKYRWFIGSEISREEYTGEKIEYVHEMAGTYYVTLVVEDANDISAVKHAVFDLDGKYVP
IANFTYQCAGLICEFDSSSASDPDGHIVERLWRFGADAMYLPGKVKETFTFPTAGEYRVA
FVVRDNDGQYNETYQFITVN
Download sequence
Identical sequences A0A167NG32
WP_063366270.1.94671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]