SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A167T8R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167T8R0
Domain Number 1 Region: 2-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000209
Family Z-DNA binding domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A167T8R0
Sequence length 77
Comment (tr|A0A167T8R0|A0A167T8R0_9EURY) Uncharacterized protein {ECO:0000313|EMBL:SAI89363.1} KW=Complete proteome OX=83986 OS=Methanoculleus bourgensis. GN=MBBA_2523 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MDEVNLPPSSRKILGLLEDGGALTHKELVRLSNLAPRTVRYALKRLKDNDMIVEKFNFRD
ARQILYEYKDSQMVSTP
Download sequence
Identical sequences A0A0X8XYT1 A0A167T8R0 I7JB31
gi|397781736|ref|YP_006546209.1| WP_014868464.1.51038 WP_014868464.1.63524 WP_014868464.1.88179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]