SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A167U8H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167U8H1
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.66e-23
Family N-acetyl transferase, NAT 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A167U8H1
Sequence length 177
Comment (tr|A0A167U8H1|A0A167U8H1_PENCH) Acetyltransferase {ECO:0000313|EMBL:KZN89026.1} KW=Complete proteome OX=5076 OS=Penicillium chrysogenum (Penicillium notatum). GN=EN45_076190 OC=Penicillium chrysogenum species complex.
Sequence
MKIQIEPAQFPEDADSILSLFSDYATSLGIDLTFQSFQEELDSLPGKYAPSQGGALLIAR
VDTGVHEYDTDGLVDTIIPPQFPSALGCVALRRSSDGWCEMKRLYVLKEARGERLGEKLV
QAILAQARALGYRGMRLDTLPEMTAAQRLYRKYGFVDIAPYYDTPIQRTVFMGCELL
Download sequence
Identical sequences A0A167U8H1 B6HNS1
jgi|Pench1|66037|e_gw1.1.2402.1 500485.B6HNS1 Pchr_Wisconsin_54-1255:Pc21g13960.t1 XP_002568413.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]