SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A167WI51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167WI51
Domain Number 1 Region: 19-174
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.8e-31
Family N-acetyl transferase, NAT 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A167WI51
Sequence length 199
Comment (tr|A0A167WI51|A0A167WI51_PENCH) N-alpha-acetyltransferase {ECO:0000313|EMBL:KZN91680.1} KW=Complete proteome OX=5076 OS=Penicillium chrysogenum (Penicillium notatum). GN=EN45_018200 OC=Penicillium chrysogenum species complex.
Sequence
MSNASDLRYVRYDNSRENEYVAAMRQLISKDLSEPYSIYVYRYFLYQWGDLCFLAMDDKD
EMVGVVVSKLEPHRDGPLRGYIAMLAVREENRGRGIATKLVRMAIDAMIERDADEIVLET
EITNTGAMKLYERLGFLRSKQLHRYYLNGNSAYRLVLYLKEGVGSIRTTFVDPYGLPPPV
PGLPDTCGGHSHANMGSLI
Download sequence
Identical sequences A0A167WI51 B6GXT2
XP_002558355.1.37043 500485.B6GXT2 Pchr_Wisconsin_54-1255:Pc12g15550.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]