SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A172T2T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A172T2T0
Domain Number 1 Region: 270-301,334-592
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.66e-48
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0001
Further Details:      
 
Domain Number 2 Region: 1-175
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.14e-35
Family H-NOX domain 0.0000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A172T2T0
Sequence length 604
Comment (tr|A0A172T2T0|A0A172T2T0_FERPE) Chemotaxis protein {ECO:0000313|EMBL:ANE41318.1} KW=Complete proteome OX=93466 OS=Fervidobacterium pennivorans. GN=JM64_04485 OC=Fervidobacterium.
Sequence
MKSFVMNIWINTWKKLYGESVVNSLIEEFKVDTSKLIIPTLDVPDDLVFQFSKKLAQRVG
KTYEELWEETGKNNVRSFSQFYPGYFKKDNCMSFLSAMDGVHRVLTRRISGAKPPRIIFN
YIDPYTAIIRYQSHRDFRYYFLGLLKGASEFFNDPIEIEILDQGSSSSGSFVEVKVRSTK
PYGKTISLKSYRALSLWTLKDFITTYTIIFPVFTFVATFLLTKFFGPLIGATLTSILALI
GVMFGLKDFRKGLDGLKEISKVYKQKDFNTLVQIKGERNFEEVSKINSEAINELREFLVG
IQGDTEELMNFSKKTLESSETVLEQIDTMKELSKQVADTAVQISNDAERISETVASNVDT
ITRTINEQNQIIHDLNLAVEKIINAAKSVEHSANGMKTMSSDFETIASESEQLRNQASAI
MEIASTVMSIAEQTNLLALNAAIEAARSGEAGRGFAVVADEIRKLAEESKASAVKISQFL
SSVSNGIDRLSQSIIKGYEELKAQSQILAQSATESKESSNIISQITQQLNSLVSTLNSET
EKLESITTSIQNLLAISEESSATAEEISASIQRFLDEINNVFANVKQTINLLNMIQDNFK
DIKI
Download sequence
Identical sequences A0A172T2T0 H9UAL6
WP_014451025.1.42624 WP_014451025.1.64957 gi|383786109|ref|YP_005470678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]