SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A173J2J7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173J2J7
Domain Number 1 Region: 4-210
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.18e-51
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A173J2J7
Sequence length 217
Comment (tr|A0A173J2J7|A0A173J2J7_9PSED) Formate dehydrogenase-N subunit gamma {ECO:0000313|EMBL:ANI54660.1} KW=Complete proteome OX=1534110 OS=Pseudomonas sp. DR 5-09. GN=PDR5_29300 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSNKTILRYTANQRTNHWLVAILFFMAGLSGLALFHPSMFWLTNLFGGGPWTRILHPFMG
VLMFVFFLGLVFRFWRSNFFIDNDWKWLRRIDRVMVNDEETVPAVGKYNAGQKLLFWTLL
LCMLGLLFTGLVIWRAYFSHYFGITTIRWAMLLHALAGFVLILSIIVHIYAGIWIKGSVD
AMMHGWVSRAWARKHHALWYREVESQDPPERPVTKKG
Download sequence
Identical sequences A0A173J2J7 Q3KCR4
gi|77458925|ref|YP_348431.1| WP_011334113.1.2668 WP_011334113.1.38776 WP_011334113.1.54700 WP_011334113.1.55771 WP_011334113.1.98588 205922.Pfl01_2700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]