SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A173SGV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173SGV3
Domain Number 1 Region: 5-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-83
Family Protein kinases, catalytic subunit 0.00000159
Further Details:      
 
Domain Number 2 Region: 477-538
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000126
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0059
Further Details:      
 
Domain Number 3 Region: 404-465
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A173SGV3
Sequence length 695
Comment (tr|A0A173SGV3|A0A173SGV3_EUBRA) Serine/threonine-protein kinase PrkC {ECO:0000313|EMBL:CUM89573.1} KW=Complete proteome OX=39490 OS=Eubacterium ramulus. GN=ERS852448_00961 OC=Eubacterium.
Sequence
MLKNGTYIADRYEVVGQIGTGGMSDVYKAKDHTLGRYVAIKVLKEEFSEDTNFVTKFRSE
AQAAAGLEHPNIVNIYDVGSENGIHYIVMEYVEGITLKTYIEKKGQLNYKEALSIAIQVS
RGIQAAHAKHIIHRDIKPQNIIISTDGKVKVTDFGIARAVSEHTIHSDVMGSVHYASPEQ
ARNGYVSNRSDIYSLGIVMYEMVTGRVPFDGDSTVAVAIQHLQDEMVPPSTYAPNLPISL
EKIIQKCTQKSPDRRYDSMESLLIDLRKALLNPNEDFVTLVPFNQDKTKTRVLTDDEVNQ
IRKQAETVNPEPEKKTMAQEVPEEDDEDYDMSEYDEDDDEEEGRFLNSKMEKIVGIMRIV
VAVIIAIIVIYLIGSFFDIFHFGPGNKNNKKDDTQITQEEKETVVMIDLKGKTLSEAEKD
LKELGLKVTEAGTEVSDTYEKGEIIDQDVSEGETVKAGTTIKVTVSAGSEEENAKEVDVP
DVTGKTSDAAMATLEDKNLTVSREFEFSNDVPAGQVIRQDPKSGSTVKEGTKVTIYVSQG
SESVKVPDVRGKSEADAKAALSEFAVTTTTEHSDSVASGNVISQSIDAGQYADKGAAITI
VISAGPEKVTYYINSKVRTDGIKDVTVTSADIELYKSESDELIQSWNGVTSFPYTIEAHG
IDVPKGTVVITWYYTDASGNAGTSTQKKEISFIKE
Download sequence
Identical sequences A0A173SGV3
WP_055289679.1.89550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]