SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A173UUX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173UUX4
Domain Number 1 Region: 443-549
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000765
Family Anti-sigma factor antagonist SpoIIaa 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A173UUX4
Sequence length 712
Comment (tr|A0A173UUX4|A0A173UUX4_9FIRM) Probable sulfate transporter Rv1739c/MT1781 {ECO:0000313|EMBL:CUN18851.1} KW=Complete proteome OX=39491 OS=[Eubacterium] rectale. GN=ERS852580_02410 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MKQKLSVAPTLKNYDKKNLPKDILAGIIIMAVSIPISMGYAQISGLPAVYGLYGSVFPII
LFALFSTSPQFIFGVDAAPAALVGAAVLGMGIEAGSKEAMTVVPVFTFFVALWLLAFYFM
NAGKLVNYISAPVMGGFITGICTTIILMQAPKLMGSAAGTGELFELSEHIWEALHHINAA
ALVMGIVALAILVVSKRLVPKFPMAVVLMVTGALFTYFGPVKEWGVPTLSAVEPGMPRWY
IPDFEAVFSVQKASEVIVLSLSVAVVIMAETLLAENNFAQKNGYRIDDNTELLAFSIGNM
AAAFTGCCPINGSVSRTAMSEQYEGKTQLTGLVAGVSMIAVLLFCTGFIGYLPVPVLTAI
VISALMGATEFHLAKRLWKVSRTEFFIFVGAFFGVLILGTINGVLIGIILSFAEMIIRSA
KPATCFLGVQPGHSHFRDIRESTNIHEIDGVIIYRFSSGLFFANAKVLVRDIEDHLKHDT
KAVIIDAGAIGSIDITGADSIESLYRSLKQKGVKLYITEHIAELNEQLRKLGLGYLIEQG
CVRRTIHIALKDMGINRPYPLEGGVDNEERSASRKRADNRVQEFVWAFGAESEEQIEKQI
KLQIEQLKKTKDIEEIMHGRWAHMDEFDQDEWLEHLEEHLKEIVNISGKDVHTLAADIEM
HRREVHERIAREHPELAERFAQRRHLLDKHLKERRPEVYRIIVQLREDNKHK
Download sequence
Identical sequences A0A173UUX4 A0A173VHG9 A0A1Q6PJR0 C4ZAK3
515619.EUBREC_0260 WP_012741185.1.21182 WP_012741185.1.32465 gi|238922685|ref|YP_002936198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]