SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A173X6P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173X6P2
Domain Number 1 Region: 2-204
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 1.15e-42
Family MPP-like 0.00039
Further Details:      
 
Domain Number 2 Region: 251-397
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 3.67e-22
Family MPP-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A173X6P2
Sequence length 403
Comment (tr|A0A173X6P2|A0A173X6P2_CLOPF) M16 family peptidase {ECO:0000313|EMBL:CUN46756.1} KW=Complete proteome OX=1502 OS=Clostridium perfringens. GN=ERS852446_00279 OC=Clostridium.
Sequence
MQKIVLNNGVRLLYKFKDIEHTSFCISLESGANVEHKDEIGMAHALEHILFKGNEKLKED
EINEKLDDLFGFNNAMTNFPYVIYYGTTAKEDFEEGFSLYADIVLNSDLQEFGFSEELNV
IKQESDEWKEDLEQHVEDLALMNGLPDERIGNLIIGEKNHIEAISFQGLKDFYERNYLSE
NMIVSVVSSLSLEEVKEIVEKNFNRAKRGKISKYNLERNINCGIFSKKIEGNTGAKICCL
FDINDLSMEEVTLLKVFNLWFGEGVSSVLYDEIRTKNGLAYEVYSEVKYEKGIRLFKIYL
GTSKEKEEEALGLIEKCISKAMDIEDYLSEEGLNKLIKRFKLKNSLDLEKSIVLANRMAI
YETMFNRGEYIFEELNLVENLSLKDMKNLIKRVLKKSIVQIIN
Download sequence
Identical sequences A0A0H2YSE4 A0A173X6P2
195103.CPF_2323 gi|110800326|ref|YP_696746.1| WP_011591041.1.30163 WP_011591041.1.50147 WP_011591041.1.52260 WP_011591041.1.5234 WP_011591041.1.52659 WP_011591041.1.68380 WP_011591041.1.81392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]