SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A173Z8T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A173Z8T4
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 1.31e-51
Family Undecaprenyl diphosphate synthase 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A173Z8T4
Sequence length 213
Comment (tr|A0A173Z8T4|A0A173Z8T4_CLOPF) Di-trans, poly-cis-decaprenylcistransferase {ECO:0000313|EMBL:CUN72822.1} KW=Complete proteome OX=1502 OS=Clostridium perfringens. GN=ERS852446_00803 OC=Clostridium.
Sequence
MRIPKHIGVIPDGNRRWAVENGLEKDQGYLHGIEPGLELFKLCQKLDIKEITYYGFTTDN
TKRPSYQKKAFIDACIKSVELIANEDCELLVIGNADSPVFPEELKKYTKRTTMGKGGIRV
NFLVNYGWEWDLNLLKACDIKSKNIYDNIQSKDISRIDLLIRWGGRRRLSGFLPVQSVYS
DIYIIDDLWPNFNKDHFFNALEWYKDQDITLGG
Download sequence
Identical sequences A0A0H2YU84 A0A173Z8T4
gi|110800504|ref|YP_696243.1| 195103.CPF_1809 WP_003468041.1.100517 WP_003468041.1.22226 WP_003468041.1.27257 WP_003468041.1.31832 WP_003468041.1.39851 WP_003468041.1.4402 WP_003468041.1.50147 WP_003468041.1.81392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]