SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A174ZGX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A174ZGX0
Domain Number 1 Region: 149-279
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.28e-17
Family HD domain 0.025
Further Details:      
 
Weak hits

Sequence:  A0A174ZGX0
Domain Number - Region: 26-94
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00141
Family Single strand DNA-binding domain, SSB 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A174ZGX0
Sequence length 314
Comment (tr|A0A174ZGX0|A0A174ZGX0_9FIRM) 3'-5' exoribonuclease yhaM {ECO:0000313|EMBL:CUQ83231.1} KW=Complete proteome OX=39485 OS=[Eubacterium] eligens. GN=ERS852492_01142 OC=Eubacterium.
Sequence
MRYIETLKDGERISEVYLCKSKSIALTKTGKEYANVMLADKTGQIDSKIWDLNSGGIAEF
DVNDYVAVTGQVTSYNGALQFKIERARIASENEYVAADYVPSSRYNIDNMFAELMKYVDS
VKSTYMKQLLYSFFKDEAFAKKFKCVSAAKTVHHGFAGGLLEHSLSVTRLCDKMSSNYDF
LNRDLLITCAMLHDVGKVKELSEFPKNDYTDEGNFLGHIVIGYEMVMEKVKQIDGFPDML
AMQIGHCILSHHGELEYGSPKKPSIAEAVALSMADNMDAKLETLREALEAKDTNDWLGYN
RWLDSNIRRTTNEF
Download sequence
Identical sequences A0A174ZGX0 C4Z415
gi|238917770|ref|YP_002931287.1| 515620.EUBELI_01851 WP_012740072.1.40640 WP_012740072.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]