SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A174ZRE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A174ZRE1
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 5.27e-34
Family Ribosomal proteins L24p and L21e 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A174ZRE1
Sequence length 103
Comment (tr|A0A174ZRE1|A0A174ZRE1_9FIRM) 50S ribosomal protein L24 {ECO:0000256|HAMAP-Rule:MF_01326} KW=Complete proteome OX=39485 OS=[Eubacterium] eligens. GN=ERS852490_02255 OC=Eubacterium.
Sequence
MSAVRIKKGDTVKVIAGKDKGKEGKVLSVNAKNHTALVEGVNMVTKHAKPSAANQQGGIL
HQEAPIDISNIAYSLKGKETKIGYDFKDGKKVRVAKATGEVID
Download sequence
Identical sequences A0A174ZRE1 C4Z2U1 R5ZSB7
WP_012738583.1.40640 WP_012738583.1.74791 WP_012738583.1.89035 515620.EUBELI_00310 gi|238916276|ref|YP_002929793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]