SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A175JHE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A175JHE6
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.53e-25
Family N-acetyl transferase, NAT 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A175JHE6
Sequence length 147
Comment (tr|A0A175JHE6|A0A175JHE6_ENTHI) Acetyltransferase gnat family {ECO:0000313|EMBL:GAT92884.1} KW=Complete proteome OX=5759 OS=Entamoeba histolytica. GN=CL6EHI_141360 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MIWHFKQLNQFTQEEVDQVYTIRKEVFSEGGEKDLGHPPMDESDQYCYHSFGWDENGIVC
YCRVIQEEQGIYKIARVLVHQNHRRKGMGQKLINYTCDQIKNLFDGKKVILSALEDIHTM
YLKIGFNKTGSFCDFNGIPAIDMQREL
Download sequence
Identical sequences A0A175JHE6 C4LW21 M3TWA9 N9UZK6
XP_649393.1.49425 294381.C4LW21 gi|56465829|gb|EAL44012.1| gi|67466491|ref|XP_649393.1| jCVI|EHI_141360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]