SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A178UPZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178UPZ2
Domain Number 1 Region: 176-239
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.75e-17
Family PHD domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A178UPZ2
Sequence length 241
Comment (tr|A0A178UPZ2|A0A178UPZ2_ARATH) AL1 {ECO:0000313|EMBL:OAO95062.1} KW=Complete proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=AXX17_At5g05110 OC=Arabidopsis.
Sequence
MAAESSNPRTVEEIFKDFSGRRSGFLRALSVDVDKFYSLCDPEMENLCLYGHPNGTWEVN
LPAEEVPPELPEPALGINFARDGMQRKDWLSLVAVHSDCWLLSVSSYFGARLNRNERKRL
FSLINDLPTLFEVVTGRKPIKDGKPSMDLGSKSRNGVKRSIEGQTKSTPKLMEESYEDED
DEHGDTLCGSCGGNYTNDEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPSCCTKKGR
Q
Download sequence
Identical sequences A0A178UPZ2 Q9FFF5
3702.AT5G05610.2-P AT5G05610.1 NP_196180.1.80155 NP_850775.1.80155 AT5G05610.1 AT5G05610.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]