SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A178UQ85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178UQ85
Domain Number 1 Region: 15-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-21
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 213-305
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000235
Family B3 DNA binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A178UQ85
Sequence length 308
Comment (tr|A0A178UQ85|A0A178UQ85_ARATH) Uncharacterized protein {ECO:0000313|EMBL:OAO95978.1} KW=Complete proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=AXX17_At5g09330 OC=Arabidopsis.
Sequence
MASNPDFLWCKEERKQESFFKVLKRSDMSSEDTRAIPYDFVINFSDNELSGDMKFRVQWG
NSWKVKISKNPRFYFMEKSGWEKFVIDNALGDHEFLTFTHKGQMSFTVKIFNKDGKEMMQ
PPQSRASFASSSRVKTEQDVKREEEVLVSSDSRSRGPTTAAETNRGGSYKRKLNFGKKKA
EETQTYKRTERTQNSKRTERVVSKERVYAGEPSSSVAGFKIFISKSYIKSLAIPKPFGNY
MPKEKTRVKIHHPDGEKTWKVVFVVKERGQIFSGGWKRLCKEYPVVFGDTCKFTLITPLE
LLLVVSKP
Download sequence
Identical sequences A0A178UQ85 Q9LXE1
AT5G09780.1 AR1788 NP_196540.1.80155 3702.AT5G09780.1-P AT5G09780.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]