SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A178UVA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178UVA2
Domain Number 1 Region: 876-1027
Classification Level Classification E-value
Superfamily SET domain 1.44e-44
Family Histone lysine methyltransferases 0.012
Further Details:      
 
Domain Number 2 Region: 199-308
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.5e-16
Family PWWP domain 0.003
Further Details:      
 
Domain Number 3 Region: 593-657
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000532
Family PHD domain 0.0084
Further Details:      
 
Domain Number 4 Region: 397-460
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000193
Family PHD domain 0.0059
Further Details:      
 
Weak hits

Sequence:  A0A178UVA2
Domain Number - Region: 700-734
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0215
Family PHD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A178UVA2
Sequence length 1027
Comment (tr|A0A178UVA2|A0A178UVA2_ARATH) Histone-lysine N-methyltransferase {ECO:0000256|PROSITE-ProRule:PRU00899, ECO:0000256|SAAS:SAAS00591749} KW=Complete proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=AXX17_At4g32140 OC=Arabidopsis.
Sequence
MIIKRKFKTQIPSLERCKLGNESRKKKRKLNLGGGGYYYPLNLLGEIAAGIVPGNGRNGF
SASWCTEVTKPVEVEESLSKRRSDSGTVRDSPPAEVSRPPLVRTSRGRIQVLPSRFNDSV
LDNWRKDSKSDCDLEEEEIECRNEKVVSFRVPKATNLKSKELDRKSKYSALCKEERFHEQ
HNDEARARVDEKLPNKKGTFGPENFYSGDLVWAKSGRNEPFWPAIVIDPMTQAPELVLRS
CIPDAACVVFFGHSGNENERDYAWVRRGMIFPFVDYVARFQEQPELQGCKPGNFQMALEE
AFLADQGFTEKLMHDIHLAAGNSTFDDSFYRWIQETAVSNQELNNNAPRQGLLKKHRNPL
ACAGCETVISFEMAKKMKDLIPGDQLLCKPCSRLTKSKHICGICKKIRNHLDNKSWVRCD
GCKVRIHAECDQISDRHLKDLRETDYYCPTCRAKFNFDLSDSEKQNSKSKVAKGDGQMVL
PDKVIVVCAGVEGVYFPRLHLVVCKCGSCGPKKKALSEWERHTGSKSKNWKTSVKVKSSK
LALEDWMMNLAELHANATAAKVPKRPSIKQRKQRLLAFLSETYEPVNAKWTTERCAVCRW
VEDWDYNKIIICNRCQIAVHQECYGARHVRDFTSWVCKACERPDIKRECCLCPVKGGALK
PTDVETLWVHVTCAWFQPEVCFASEEKMEPAVGILSIPSTNFVKICVICKQIHGSCTQCC
KCSTYYHAMCASRAGYRMELHCLEKNGQQITKMVSYCAYHRAPNPDNVLIIQTPSGAFSA
KSLVQNKKKGGSRLISLIREDDEAPAENTITCDPFSAARCRVFKRKINSKKRIEEEAIPH
HTRGPRHHASAAIQTLNTFRHVPEEPKSFSSFRERLHHLQRTEMDRVCFGRSGIHGWGLF
ARRNIQEGEMVLEYRGEQVRGSIADLREARYRRVGKDCYLFKISEEVVVDATDKGNIARL
INHSCTPNCYARIMSVGDEESRIVLIAKANVAVGEELTYDYLFDPDEAEELKVPCLCKAP
NCRKFMN
Download sequence
Identical sequences A0A178UVA2 Q9SUE7
NP_194520.3.80155 AT4G27910.1 AT4G27910.1 3702.AT4G27910.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]