SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A178VEN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A178VEN1
Domain Number - Region: 154-220
Classification Level Classification E-value
Superfamily TSP9-like 0.0432
Family TSP9-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A178VEN1
Sequence length 391
Comment (tr|A0A178VEN1|A0A178VEN1_ARATH) Uncharacterized protein {ECO:0000313|EMBL:OAP04041.1} KW=Complete proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=AXX17_At3g00840 OC=Arabidopsis.
Sequence
MGESACLMQPFSYAAPQGDSLGALGQSVSFGRFMSEKLDWEKWSAFSTQNPYVAEAERYS
KPGSVAQKKAFFEAHYKKVAAARKAAAEEALLLQQQIPKPQPEKSPVQEEDINEGEKKDW
MVSKPDLEIPRGSLDVSAQLKLLAEKEGRFSNRQSDEKENCGMAESEINGRTAEEQVDEE
KPILKSVKKKSKDSQPKSSTKPRVSKYNSSERTPSKKSNNKSSSYTFTPAKEFNRLVSII
RKIDGSRASSKPTKDCKTPLRTPSNKVSAKGMVEDSLSTPLSSNTSKCRGKIAPNSSAKT
GRGRWNFLPAETPSCFTPFGLRTEERAERRKKKLEGKFKEMETQNQKAEERSVEKEESKL
RQRLCFKAKPLPNFYKQRPKSTDQTKKALLQ
Download sequence
Identical sequences A0A178VEN1 F4J761
3702.AT3G01710.1-P NP_566147.3.80155 AT3G01710.1 AT3G01710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]