SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A178VJY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178VJY9
Domain Number 1 Region: 1277-1338
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.32e-17
Family PHD domain 0.0018
Further Details:      
 
Domain Number 2 Region: 79-139
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000354
Family PHD domain 0.011
Further Details:      
 
Domain Number 3 Region: 261-308
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000425
Family Methyl-CpG-binding domain, MBD 0.045
Further Details:      
 
Weak hits

Sequence:  A0A178VJY9
Domain Number - Region: 1180-1243
Classification Level Classification E-value
Superfamily Bromodomain 0.000314
Family Bromodomain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A178VJY9
Sequence length 2176
Comment (tr|A0A178VJY9|A0A178VJY9_ARATH) MBD9 {ECO:0000313|EMBL:OAP06084.1} KW=Complete proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=AXX17_At3g00560 OC=Arabidopsis.
Sequence
MEPTDSTNEQLGDTKTAAVKEESRSFLGIDLNEIPTGATLGGGCTAGQDDDGEYEPVEVV
RSIHDNPDPAPGAPAEVPEPDRDASCGACGRPESIELVVVCDACERGFHMSCVNDGVEAA
PSADWMCSDCRTGGERSKLWPLGVKSKLILDMNASPPSDAEGYGAEETSDSRKHMLASSS
CIGNSFDYAMMHSSFSSLGRGHASLEASGLMSRNTKMSMDALGSHNLGFGFPLNLNNSSL
PMRFPSLDPSELFLQNLRHFISERHGVLEDGWRVEFRQPLNGYQLCAVYCAPNGKTFSSI
QEVACYLGLAINGNYSCMDAEIRNENSLLQERLHTPKRRKTSRWPNNGFPEQKGSSVSAQ
LRRFPFNGQTMSPFAVKSGTHFQAGGSLSSGNNGCGCEEAKNGCPMQFEDFFVLSLGRID
IRQSYHNVNVIYPIGYKSCWHDKITGSLFTCEVSDGNSGPIFKVTRSPCSKSFIPAGSTV
FSCPKIDEMVEQNSDKLSNRRDSTQERDDDASVEILLSEHCPPLGDDILSCLREKSFSKT
VNSLRSEVDSSRVDFDKNLSYDQDHGVEIGDIVVEEDSLSDAWKKVSQKLVDACSIVLKQ
KGTLNFLCKHVDRETSEINWDTMNEKDNVILSLSKFCCSLAPCSVTCGEKDKSEFAAVVD
ALSRWLDQNRFGLDADFVQEMIEHMPGAESCTNYRTLKSRSSSSVPITVAEGALVVKPKG
GENVKDEVFGEISRKAKKPKLNGGHGVRNLHPPPGRPMCLRLPPGLVGDFLQVSEVFWRF
HEILGFEEAFSPENLEQELINPVFDGLFLDKPGKDDKRSEINFTDKDSTATKLFSLFDES
RQPFPAKNTSASELKEKKAGDSSDFKISDSSRGSCVGALLTRAHISLLQVLICELQSKVA
AFVDPNFDSGESRSRRGRKKDDSTLSAKRNKLHMLPVNEFTWPELARRYILSLLSMDGNL
ESAEIAARESGKVFRCLQGDGGLLCGSLTGVAGMEADSMLLAEAIKKISGSLTSENDVLS
VEDDDSDGLDATETNTCSGDIPEWAQVLEPVKKLPTNVGTRIRKCVYEALERNPPEWAKK
ILEHSISKEIYKGNASGPTKKAVLSLLADIRGGDLVQRSIKGTKKRTYISVSDVIMKKCR
AVLRGVAAADEDKVLCTLLGRKLLNSSDNDDDGLLGSPAMVSRPLDFRTIDLRLAAGAYD
GSTEAFLEDVLELWSSIRVMYADQPDCVDLVATLSEKFKSLYEAEVVPLVQKLKDYRKLE
CLSAEMKKEIKDIVVSVNKLPKAPWDEGVCKVCGVDKDDDSVLLCDTCDAEYHTYCLNPP
LIRIPDGNWYCPSCVIAKRMAQEALESYKLVRRRKGRKYQGELTRASMELTAHLADVMEE
KDYWEFSAEERILLLKLLCDELLSSSLVHQHLEQCAEAIIEMQQKLRSLSSEWKNAKMRQ
EFLTAKLAKVEPSILKEVGEPHNSSYFADQMGCDPQPQEGVGDGVTRDDETSSTAYLNKN
QGKSPLETDTQPGESHVNFGESKISSPETISSPGRHELPIADTSPLVTDNLPEKDTSETL
LKSVGRNHETHSPNSNAVELPTAHDASSQASQELQACQQDLSATSNEIQNLQQSIRSIES
QLLKQSIRRDFLGTDASGRLYWGCCFPDENPRILVDGSISLQKPVQADLIGSKVPSPFLH
TVDHGRLRLSPWTYYETETEISELVQWLHDDDLKERDLRESILWWKRLRYGDVQKEKKQA
QNLSAPVFATGLETKAAMSMEKRYGPCIKLEMETLKKRGKKTKVAEREKLCRCECLESIL
PSMIHCLICHKTFASDDEFEDHTESKCIPYSLATEEGKDISDSSKAKESLKSDYLNVKSS
AGKDVAEISNVSELDSGLIRYQEEESISPYHFEEICSKFVTKDCNRDLVKEIGLISSNGI
PTFLPSSSTHLNDSVLISAKSNKPDGGDSGDQVIFAGPETNVEGLNSESNMSFDRSVTDS
HGGPLDKPSGLGFGFSEQKNKKSSGSGLKSCCVVPQAALKRVTGKALPGFRFLKTNLLDM
DVALPEEALRPSKSHPNRRRAWRVFVKSSQSIYELVQATIVVEDMIKTEYLKNEWWYWSS
LSAAAKISTLSALSVRIFSLDAAIIYDKPITPSNPIDETKPIISLPDQKSQPVSDSQERS
SRVRRSGKKRKEPEGS
Download sequence
Identical sequences A0A178VJY9 Q9SGH2
3702.AT3G01460.1-P NP_186795.1.80155 AT3G01460.1 AT3G01460.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]