SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A178W8F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A178W8F1
Domain Number 1 Region: 74-133
Classification Level Classification E-value
Superfamily DNA-binding domain 1.5e-22
Family GCC-box binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A178W8F1
Sequence length 262
Comment (tr|A0A178W8F1|A0A178W8F1_ARATH) HRE1 {ECO:0000313|EMBL:OAP14618.1} KW=Complete proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=AXX17_At1g66540 OC=Arabidopsis.
Sequence
MCGGAVISDYIAPEKIARSSGKSSWRSNGVFDCSIYDFDGNFDELESDEPFVFSSTHKHH
ASGSASDGKKKQSSRYKGIRRRPWGRWAAEIRDPIKGVRVWLGTFNTAEEAARAYDLEAK
RIRGAKAKLNFPNESSGKRKAKAKTVQQVEENHEADLDVAVVSSAPSSSCLDFLWEENNP
DTLLIDTQWLEDIIMGDANKKHEPNDSEEANNVDASLLSEELLAFENQTEYFSQMPFTEG
NCDSSTSLSSLFDGGNDMGLWS
Download sequence
Identical sequences A0A178W8F1 F4IDA7
NP_001077812.1.80155 GO.4500 AT1G72360.2 3702.AT1G72360.2-P AT1G72360.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]