SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A183KL88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A183KL88
Domain Number 1 Region: 184-267
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.46e-26
Family Ran-binding protein mog1p 0.001
Further Details:      
 
Domain Number 2 Region: 58-165
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 0.00000915
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A183KL88
Sequence length 275
Comment (tr|A0A183KL88|A0A183KL88_9TREM) Uncharacterized protein {ECO:0000313|WBParaSite:SCUD_0001580501-mRNA-1} KW=Complete proteome; Reference proteome OX=6186 OS=Schistosoma curassoni. GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MEAYKPGDQIFMDYGNRSNEDFFMFSGFIPHVNLNNKLTITLGNPLKCDLRGDIESMTEF
LIFSRIFCMDKDELNKYLVDSKSNHIIMKLELSSFEFNKEIACEHKALSFMINRLKLLIA
AYGTLLLEDTPEWNQLTLIQQNCERLKHHEVNILRSSIENIQNILDSSYNDNFPFTYFTM
FNTMQSHPLFDGAFQCLLPTNVVDASDLRQIPDNQEVFVHPSTSQSITIDILEYVDASNH
EDAARMHFDEIGAANEATDSNISSLRTVSLHNPDP
Download sequence
Identical sequences A0A183KL88

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]