SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A195E3B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A195E3B1
Domain Number 1 Region: 782-903
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.03e-35
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-20
Family PDZ domain 0.0075
Further Details:      
 
Domain Number 3 Region: 1091-1169
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.07e-18
Family Ras-binding domain, RBD 0.0068
Further Details:      
 
Domain Number 4 Region: 195-304
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000492
Family Phosphotyrosine-binding domain (PTB) 0.0097
Further Details:      
 
Domain Number 5 Region: 1037-1101
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000351
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A195E3B1
Sequence length 1486
Comment (tr|A0A195E3B1|A0A195E3B1_9HYME) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KYN19650.1} KW=Complete proteome; Reference proteome OX=471704 OS=Trachymyrmex cornetzi. GN=ALC57_08126 OC=Vespoidea; Formicidae; Myrmicinae; Trachymyrmex.
Sequence
MHQNRRKKKRVNYGVRAVEVVRGAKGFGFTISGQQPCILSCIVQGSPAEAAGLRAGDYLV
AVNGHNVSKVPHDDVVQLIGSSKGILRLQIAENYYSDSSDEEGLATVRSKPKYAHKPRTA
SAGALQLQCRAAKVVRDLQSGAMFHTVPGGLAMSDAKDQYNYSGLHYRWNMTSPLPLPPP
PASHKRDSEKIVHRTVVGYLGTIDIPNQLHPSCMMQVLRKCIKRLKAEKRNPTTVLLTIH
VANIKLTNSENRIIAEYPSYRIIFCNSFSEQDKQYFGILTKSMRNTDDIVSNSCHVFTIY
YKLIDHEVHSSACNVFGFMCTKSSELNVCQEFPDSCTSLIGAIQTLYISDCTNGENCTNP
YNEARIRLDTASPQPSNISTSTAHSSNSDSGIGFKDDYGSCSSKNLANDCERRRHYSNMQ
YRNVSARLSKEPVNEAAGHRLTVRATSEARLWSEELKFDPSKEMRHVAGSGEGTTTTCAG
TSAPAATARTMFASTSVGSLASVCTTALLDGIEDAAESSKVASTEGLKRLMDATNKLSPK
VYCGQVTKSLVHSLEDINSSMEYARQPYCHSYSGKSDKPRPWGSLQEIRNFRSSASDNCI
NVREIISFSLVSHEFRLLPKMCISNVHINAPRFVVANDFRFLSCTHYSQLRHRFLPLICA
RAHRQGSSENRNQIGSVRTCSRVLFTPHALAYDYFICFSVVTHRGERGSNRVAHGVCSRD
DVADDYVVLATHYRYCQQLIVLSSPTSTSSALLPIPRQNMQSSYGSTESCDKNNDCKGVH
IWANGFEKLLEDPKGLQTFAEFLKKEFSHENIYFWAACERYKDTKDTTMRRRLACQIYQR
HLSNTAAEPVNVDSHASGQITQELLDEAPADLFLQTQKQVFNLMKFDSYPRFLRSELYRA
CLEAGSAVIDTEDCDLHLTSSPSVKLKKSHSDAEDRRRKSLLPWNRKNRSKSKDRGESEY
NKTPSRSETIYKSFTVIKRETEGNNNEDTVSISSSRSSLASWDLALRQSFNKHSVSSYDG
QTNEKKDARSKCTGLSRVILPDGSTTVVTTSQTESIKDVVTRLLDKRALRYSNYDVLILA
TDEMVDTKCFSSVLAGQEVEVVPTKVLKVELPSRRIISIIAHKGKTLKEVLRPLLNKYGF
NLDLISIWSEGRCVPMDIMAISAPTRIIVMANEEDFQRELHTAKYLDEMQHAQPTLDEIT
NKVFEELLVGKSRNKYQYSEGSCKSDDQRSEGSSILSSKFFLRDSTIHGKKKAKSKCCNT
SEKGNSNDCIHEGAPIKSQPPLIAKWRNGVKLQLPGRFDGDELYEGLKRAQRSRLEDQRG
TEINFELPDFLKNKENGKPSDSNKMRRTRVVSANYESTTKFYDSSEDKQSSSGYEYSAHV
TNGAANERFSALVNITEPLSKCLESSFNLDCDRTLVDGDQTIIENGTDSPSKSPHSGSYG
GTDVSHTKLSKPPPLPPKPKNLVVNVVKSGYITSPKTLQRPNHVIE
Download sequence
Identical sequences A0A195E3B1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]