SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A195FSL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A195FSL0
Domain Number 1 Region: 756-882
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-36
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-20
Family PDZ domain 0.0075
Further Details:      
 
Domain Number 3 Region: 1070-1149
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-19
Family Ras-binding domain, RBD 0.0068
Further Details:      
 
Domain Number 4 Region: 195-304
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000383
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 
Domain Number 5 Region: 1014-1080
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000496
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A195FSL0
Sequence length 1465
Comment (tr|A0A195FSL0|A0A195FSL0_9HYME) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KYN43282.1} KW=Complete proteome; Reference proteome OX=34720 OS=Trachymyrmex septentrionalis. GN=ALC56_02230 OC=Vespoidea; Formicidae; Myrmicinae; Trachymyrmex.
Sequence
MHQNRRKKKRVNYGVRAVEVVRGAKGFGFTISGQQPCILSCIVQGSPAEGAGLRAGDYLV
AVNGHNVSKVPHDDVVQLIGSSKGILRLQIAENYYSDSSDEEGLATVRSKPKYAHKPRTA
SASALQLQCRAAKVVRDLQSGAMFHTVPGGLAMPDAKDQYNYSGLHYRWNMTSPLPLPPP
PASHKRDSEKIVHRTVVGYLGTIDIPNQLHPSSMMQVLRKCIKRLKAEKRNPTTVLLTIH
VANIKLTNSENRIIAEYPSYRIIFCNSFSEQDKQYFGILTKSMRNTDDIVSNSCHVFTIY
YKLIDHEVHSSACNVFGFMCTKSSELNVCQEFPDSCTSLIGAIQTLYISDCTNGENCTNP
YNEARIRLDTASPQPSNISTSTAHSSNSDSGIGFKDDYGSCSSKNLANDCERRRQYSNMQ
YRNVSARLSKESVSEAAGHRLTVRATSEARLWSEELKFDPSKELFTEMRHVAGSGEGTTT
TCAGTSAPAATARTMLASTSVGSLASVCTTALLDGIEDAAESSKVVSTEGLKRLMDTTNK
LSPKVYCGQVTKSLVHSLEDINSSMEYARQPYCHSYSGKSDKPRPWGSLQEIRNFRSSAS
DNCIRWKRKRSGASDGSTMRMNQSRTTLRERPKARSSSRLAPWLGDARSSRWAEPSLLHK
QIIHLALVADVDVVRSFTYSAPKYAIVARKKSHGQVCSGCSAVHRERCCMRHVSLSPRQF
IDDAWFGKFGMDPFLGKVSSPVYGSTESCDKNNDCKGVHTWANGFEKLLEDPKGLQTFAE
FLKKEFSHENIYFWAACERYKDTKDTTMRRRLACQIYQRHLSNTAAEPVNVDSHASGQIT
QELLDEAPADLFLQTQKQVFNLMKFDSYPRFLRSELYRACLEAGSAVVDTEDCDLHLTSS
PSVKLKKSHSDAEDRCRKSLLPWNRKNRSKSKDRGESEYNKTPSRSETIYKSFTVIKRET
EGNNNEDTVSISSSRSSLASWDLALRQSFNKHSVSSYDGQTNEKKDARSKCTGLCRVILP
DGSTTVVTTSQTESIKDIVTRLLDKRALRYSNYDVLILATDEMVDTKCFSSVLAGQEVEV
VPTKVLKVELPSRRIISIIAHKGKTLKEVLRPLLNKYGFNLDLISIWSEGRCVPMDIMAI
NAPTRIIVMANEEDFQRELHTAKYLDEVPHAQPTLDEITNKVFEELLVGKSRNKYQYSEG
SCKSDDQRSEGSSILSSKFFLRDSTIHGKKKAKSKCCNTSEKGNSNDCIHEGAPIKSQPP
LIAKWRNGVKLQLPGRFDGDELYEGLKRAQRSRLEDQRGTEINFELPDFLKNKENGKPSD
SNKMRRTRVVSANCESTTKFYDSSEDKQSSSGYEYSAHVTNGAANERFSALVNITEPLSK
CLESSFNLDGDRTLMDGDQTIVENGTDSPSKSPYSGSYGGTDVSHTKLSKPPPLPPKPKN
LVVNVVKSGYIASPKTLQRPNHVIE
Download sequence
Identical sequences A0A195FSL0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]