SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A198YTG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A198YTG4
Domain Number 1 Region: 95-357
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-79
Family D-glucarate dehydratase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.57e-31
Family Enolase N-terminal domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A198YTG4
Sequence length 382
Comment (tr|A0A198YTG4|A0A198YTG4_9RHIZ) D-galactonate dehydratase {ECO:0000313|EMBL:OAV53383.1} KW=Complete proteome OX=1825933 OS=Rhizobium sp. WYCCWR10014. GN=A6U98_05285 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MKITKLTTYIVPPRWLFLKVETDEGIVGWGEPVVEGRALTVQAAVHELEDYLIGKDPFLI
EDHWTVMYRGGFYRGGAVHMSAISGIDQALWDIKGKALGQPIHSLLGGQLRDRIKVYSWI
GGDRPSDVANNAKEVVARGFKAIKLNGCEEMQIVDTNEKVEKAVETIAAIREAIGPHIGI
GVDFHGRVHKPMAKVLAKELDPYKLMFIEEPVLSENKEALRDIVNHTSTPIALGERLFSR
WDFKQVLSDGYVDIIQPDLSHAGGITECRKIAAMAEAYDVALAPHCPLGPIALAACLQVD
AVSYNAFIQEQSLGIHYNKGNDILDYISNKEVFQYADGFVSIPQGPGLGIEVDEAYVIER
AKEGHRWRNPIWRHADGSFAEW
Download sequence
Identical sequences A0A198YTG4 C6AX86 Q1MBG1
gi|241206453|ref|YP_002977549.1| WP_011653629.1.14669 WP_011653629.1.53928 WP_011653629.1.54942 WP_011653629.1.67177 WP_011653629.1.78351 WP_011653629.1.81419 WP_011653629.1.99504 gi|116253970|ref|YP_769808.1| 216596.RL4233 395491.Rleg_3767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]