SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A0HBY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A0HBY8
Domain Number 1 Region: 58-137
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000484
Family MgtE N-terminal domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A0HBY8
Sequence length 159
Comment (tr|A0A1A0HBY8|A0A1A0HBY8_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:OBA21526.1} KW=Complete proteome; Reference proteome OX=869754 OS=Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993. GN=METBIDRAFT_187354 OC=Saccharomycetes; Saccharomycetales; Metschnikowiaceae; Metschnikowia.
Sequence
MAEIMTETMAEIMTEIIAGIMTEIISEIISEIIAGIMTEIISEIISEIISEIMAEIISEI
ISEIMAEIMAEIMAEIMTEITPEIMAEIMAEIMAEIMTEIMTEITPEVMAEIMAEIMAEI
MAEIMTEITPEIMAEIMTEIMTQIYIRLWVGFTSVLAED
Download sequence
Identical sequences A0A1A0HBY8
jgi|Metbi1|187354|CE98015_188 XP_018712036.1.9870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]