SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A7YFZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7YFZ6
Domain Number 1 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-54
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 2 Region: 634-889
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-54
Family YWTD domain 0.00000418
Further Details:      
 
Domain Number 3 Region: 333-571
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 4 Region: 937-1198
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-40
Family YWTD domain 0.000041
Further Details:      
 
Domain Number 5 Region: 1327-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 892-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000413
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 1247-1288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 8 Region: 589-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000785
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 9 Region: 1289-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 10 Region: 288-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 1206-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000429
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A7YFZ6
Sequence length 1617
Comment (tr|A0A1A7YFZ6|A0A1A7YFZ6_9TELE) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} OX=60296 OS=Aphyosemion striatum. GN=LRP6 OC=Aphyosemion.
Sequence
MGVALQSLLLCTFCCLIRGEPLLLYANRRDLRIADVAHEKANATVVVGGLEDAAAVDYVY
SRGLIYWSDVSEEAIKRTFYSQSGSSLVQTVVPGLTSPDGLACDWLGSKLYWTDSETNRI
EVAELDGSLRKVLFWLDLDQPRAIALDPERGFMYWTDWGEVPKIERAGMDGTNRSIIIDK
EINWPNGLTLDYAQQKLYWADAKHNFIHRCNLDGSSREVVVKGELPHPFALTLFEDTLFW
TDWTTHSIHSCQKQTGNEQRIVHSNIFSPMDIHVFSPKRQPVSLSSSCSLNNGGCSHLCL
LSPTRPFYRCACPTGVQLLEDGKTCRDGATQMLLLARRTDLRRISLDTPDFTDIILQVED
IRHAIAVDYDPVEGYIYWTDDDVKAIRRSLLDGSDSQFVVVAQVSHPDGIAVDWIARNLY
WTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYLYWTDWGEVPKIERANLDG
TERVVMVNTTLGWPNGLALDYNELKIYWGDAKMDRIEVMNMNGTGRRVLVEDKIPHIFGF
TILGDYIYWTDWQRRSIERVHKHTAEREFIIDQLPDLMGLKAVNVHEAVGTNPCADNNGG
CSHLCLYTPHGVQCGCPIGLELIADMQTCIVPEAFLLFSRHTDIRRISLETNNNNVPIPL
TGVMEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVQFGLDYPEGMAVDWLGKN
LYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAM
DGTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGLDREVIADDLPHPFGL
TQFQDYIYWTDWSQRSIERANKTSGQNRTLIQGHLDYVMDILVFHSSRQGGWNACASTNG
HCSHLCLAVPVSSYVCGCPAHFSLNYDNKTCRAPTSFLLFSQKNSINRMVIDEQQSPDII
LPIHNLKNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSMTVVLSSVVGPSPGLQLYD
LSIDIYSRFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIMVNPERGYMYFTNLQE
RSPKIERAALDGTEREVLFFSGLGKPVALAIDNEMGKLFWVDSDLRRIESSDLSGANRIV
IADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKVQARVAYLSDIHAVHELD
MTEYRKHPCTNDNGGCSHICIVKGDGTTRCSCPIHLVLLPDELTCGEPPTCSPEHFACKS
GEVDCIPNTWRCDGYPECDDRSDEEDCPVCSDSEFQCDSRQCIDLSLRCNEEINCQDGSD
ENKCEVRCPADQFTCSNGQCIGKHKKCDHNMDCSDNSDEIGCYPTEEPPPPSNNTISSIV
GVVMALFGVGAIYFVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHPSSLSSSLPG
MSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQY
TLEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRAPLKSAAATKGY
TSDINYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A1A7YFZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]