SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A8RS57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8RS57
Domain Number 1 Region: 137-379
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-51
Family YWTD domain 0.00000206
Further Details:      
 
Domain Number 2 Region: 438-699
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-50
Family YWTD domain 0.00000617
Further Details:      
 
Domain Number 3 Region: 747-1001
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-36
Family YWTD domain 0.000065
Further Details:      
 
Domain Number 4 Region: 1-80
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000209
Family YWTD domain 0.001
Further Details:      
 
Domain Number 5 Region: 1132-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1055-1094
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 7 Region: 703-750
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.019
Further Details:      
 
Domain Number 8 Region: 1095-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 9 Region: 91-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000678
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 10 Region: 393-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1013-1065
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8RS57
Sequence length 1434
Comment (tr|A0A1A8RS57|A0A1A8RS57_9TELE) Low density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:SBS08059.1} OX=451742 OS=Nothobranchius rachovii (bluefin notho). GN=LRP5 OC=Nothobranchius.
Sequence
KLYWADAKLSFIHRANLDGSAREAVVEGTLTHPFALTLSEETLYWTDWQTRSIHACNKHS
GDKSREILGGIYSPMDIQVLELYRQPYIQTPCSENNGGCSHLCLLSPVQPFYSCACPTGV
QLKADRKTCKPGAEEVLLLARRTDLRRISLDLPDFTDILLEVNDIRHAIAIDYDPVEGLV
YWTDDEVQAIRRSHIDGRNAVVLVSTELKHPDGIAVDWVARNLYWTDTGTDRIEVTRLNG
TSRKILISENLDEPRAIVLDPVNGYMYWTDWGEHPKIERANLDGTDRVVLLNTSLGWPNG
LALDNAAGKLYWGDAKTDKIEVISVNGSNRQTLLEDKLHHIFGFTLLGDYIYWTDWQRRS
IERVHKSTAVREIIIDQLPDLMGLKATKVAVTHGTNGCAVDNGGCSHLCFWCQRAVRCAC
PMGLELLSDLHTCVVPEAFLLFTNRDSIRSISLGTNSNDVAIPLTGVKEASVLGFDVSEK
RIYWTDIQAKKISRAFMNGSSVEHVVEFGLDYPEGMAIDWMGRNIYWADTGTNRIEVAQL
DGQYRQVLVYKDLDNPRSLDNPRSLALDPANGYMYWTEWGGRPRIARAYMDGNTIVTLVD
KVGRANGLTIDYVDHRLYWTDLDTCMIESTNMQGLQREIIVDDLPHPFGLTQYRDFIYWT
DFNLRSIERADKRGGFNRTVVLQGQLELMLDILVFHSSRQDGTNECSHNNGNCAHLCLAT
PAGPQCHCASHYILSPDGTNCSSPSSFLLFSQKASISRTVLGEQSPDIVLPIHITRNVRT
IKYDPLDHLVYWLDGRQNIRRARDDGTMASTVVSSTAQQVDNQIHDLSLDPYSRHIYWTC
ETTNTINVQRMDGHIVGVVVKDDTDKPRAIVVNAEKGYMYFTTTQERSAKIERASLDGTE
RESLFTTGLIRPVALALDNTLGKLFWVDADLKRIESSDLTGANRIVLQDSNILQPIGITV
LGDHLYWIDRQQQMIERVNKVTGDGRTRIQGRILYLTAIHAVEEMDPQEFASHPCSRDNG
GCSHICIAKGDGTPSCSCPMHLVLLQDLLHCGEPPTCSTEQFTCSTGEIDCIPMAWRCDG
LAECEDSSDEENCPICSAFHFQCDGGSCIDAQRRCDGEPDCADKSDEQDCETICPPTQFR
CGDNQCITRKQQCDNYSDCLDGSDELACDYTSTSSSIVPSYEPTNPIGAVIAIILLVFVM
GGACFACQRVVCRRYKGPNGTFPHEYISGTPHVPLNFITPSSSQHGTYQGISCEKSIMSS
VSLMGSSSSRAPLYDRNHVTGASSSSSSSTKGVFYPQILNPPPSPATDRSFYNTEIFYSS
NSPSTIRSYRPYHLIRGAAPPTTPCSTDVCDSDYTPHHPPTALPSSAGCWKASGHGKPNK
YYMDLNSDSDPYPPPPTPRSQYLSAEESCPPSPSTERSYFHLCPPPPSPCTDSS
Download sequence
Identical sequences A0A1A8RS57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]