SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A8RWQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8RWQ0
Domain Number 1 Region: 283-420,447-487
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.98e-28
Family Hemopexin-like domain 0.0009
Further Details:      
 
Domain Number 2 Region: 67-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000129
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 27-65
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000379
Family Somatomedin B domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8RWQ0
Sequence length 543
Comment (tr|A0A1A8RWQ0|A0A1A8RWQ0_9TELE) Proteoglycan 4a {ECO:0000313|EMBL:SBS10416.1} OX=451742 OS=Nothobranchius rachovii (bluefin notho). GN=PRG4A OC=Nothobranchius.
Sequence
MKKRMKNLGFLLIGTFAAFAAAVAGPGSCVGRCGEVFTRGQQCTCDSNCIQHNECCPDYQ
ATCITAQSCRGRCGETFRRGLLCECDPLCIQFNTCCQDYRLHCDATVPVSQPGSLQSRRT
TVSRVWKPDRNRRRSNSESEEWQPARSRCSQLPGARCHSRLVLSHPSSGPAPPAGTNHQH
GGSKVITGLQPLPFSPHGTHHHQHLPSNSAPALGSSMRPSTPGDDGGKQDIHLVVFPAGI
NPFGPSESFGGPAASGSSTLPQPLGLPLGDGGLDGSGVLQDVNLCSDSPINGLTALSNGT
ILIFKGELFWSVDPIRRSVGRPQNITETLGVSSPIDTVFTRHNCNGNTYIIKGDQYWRLD
GNMVMEPGYPKPLSSEFPGLTGTISAVLAVPASSTGPETLFFFKEGDLLQRFIFPPGSTP
SCIENPRSFPDRRFTPQTEFLLSGEINIKVSLTGFPTPITSALSMPGSQNVSRHQHFVFT
GPIFFRVQISGSLPALVTPEPPDALQPLPFLRPAVLMSNSNAAGLNPRPPHPQNSIRLWL
RCP
Download sequence
Identical sequences A0A1A8RWQ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]