SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A9WWQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9WWQ9
Domain Number 1 Region: 804-929
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.93e-35
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1101-1184
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-22
Family Ras-binding domain, RBD 0.0042
Further Details:      
 
Domain Number 3 Region: 42-124
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-19
Family PDZ domain 0.0074
Further Details:      
 
Domain Number 4 Region: 261-346,373-391
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000116
Family Phosphotyrosine-binding domain (PTB) 0.0096
Further Details:      
 
Domain Number 5 Region: 1044-1112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000887
Family Ras-binding domain, RBD 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A9WWQ9
Sequence length 1496
Comment (tr|A0A1A9WWQ9|A0A1A9WWQ9_9MUSC) Uncharacterized protein {ECO:0000313|VectorBase:GBRI035212-PA} KW=Complete proteome; Reference proteome OX=37001 OS=Glossina brevipalpis. GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MHHHHLPQPTKNNVNVPTSTSAAGNATTGITTQQQRRRKKRPNYGTRTLEVRRGFSGFGF
TISGQQPCRLSCIVSNSPADQAGLRAGDFLISVNGLNVSKLPHETVVQLIGNSFGSIRMQ
IAENYYSDSSDEENATLQQNPHSLGFHNISGLRYLHHKTKLHRMRNSPQKKRGEASLKHK
VQIERAQTKKTLKEVSKKHMVESLTLSHLSPLMEDLPLRPLSVTNESTKPCSTPAAVYNS
NVANVSAMVRVPSNALEYRAVVGYLGTIEMPKQISQSSKLQTVRSCIRKLRQEKRQPSTV
LMIILPDSLRLQASNGTILATYASSRLSYVSSSSESENRFFGLVTSAVHSTPLDEDNDEQ
DNEAPTLSSSVTSHITISNSCHVFVVDTKLCEHQLHLERAQDFHIECTKDLISSLCLEFP
SNSEYVVNLIRSMYTMRILPPATQRCNSGDHYAQAAGGEAAHSPQPSNHSEISTTTSNSD
SGIGFHNDCRNISDRIVVVDFPQVDYFPIRSMGIQSSRPMGIFQRLNLEQASSPVISSEN
KRLSVRALADTVSKPISSINGFMTTRSCDDVLSLLENDETVAPSYTNHQHVSVDDIPLHN
VSLSGEDRKSFLHPSSTEQDNSYLLSETLAPNKPRRSKQVPDKLSPQVYDLGISIIKAPK
CKVPAKNCTVSECKLSEDAFTILNETSDENNGNRNLQDLPQKQAAVKSAKYLELVSSEPD
LCASTDTSFLSQRRSWMQSSLRTIRSDKHTANRKEKLSNDNNICLLQRSVSLSEKVHNND
LEEKHMTPLTDHRKNEKELNESTRVSAWATSFVNLLEDPLGVKTFAEFLRLEYSAENIYF
WTACERFRHIESEAERIIQAKIIFAKHLSEVATEPVNVDSQARNAVEKKLRQSADVDVFA
VAQKQIFNLMKYDSYQRFIRSDLYKKTLQAQERGECLPYEKDNLDDLLKTNFTSDASTNL
KKSASNAEDRRRKSLLPWHRKMRRKSRELSEENAHRQVCKNFGLKNKSQRQTFFNDLHGS
RSSLSSYDASIVGSAASLNVNTPLCRVKLPDGSTTIIQIQLEESVGELVKRILEKRGLNY
RIYEVFVRGLTTKPINLQTLSQEIAGKEVEVEQRVAFKLDLPDFKVISVKSKPRKTLHEV
MKPILQKYNYQLEDVETICKDTKEKIDLHQHVVRVDGQRLQVLMKTNKIKFVKPLPVKAN
IPIVKGINAQITLDEMTNTVFKNLMEGKLQNRNYKKSNDLNSLKSNDCDSHTSSISDRIR
SKRRDSANLINLGNMKTKKKLQVKAAYDELVPFNKTISNNLKGANCKLPFDKSVAEKMIE
NQDELLEGLKRAQLARLEDQRGTEINFELPDFLKNKENLLKSLNRNTENTSKNKCRYGTY
MGRPQPAPRLSITNKNRLINADEQSSIRCNSEAQLLTTSTSKSPPPLPPKPKVLPIKPSN
WGVATTHSTNSSIITTTGPQIFNKLSKTTEAVTGATINKVALIAAAYLEEPSSSFV
Download sequence
Identical sequences A0A1A9WWQ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]