SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1B0ET31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B0ET31
Domain Number 1 Region: 854-981
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.64e-38
Family Regulator of G-protein signaling, RGS 0.0000963
Further Details:      
 
Domain Number 2 Region: 1158-1243
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-21
Family Ras-binding domain, RBD 0.0051
Further Details:      
 
Domain Number 3 Region: 7-91
Classification Level Classification E-value
Superfamily PDZ domain-like 2.26e-20
Family PDZ domain 0.0065
Further Details:      
 
Domain Number 4 Region: 1099-1167
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000388
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 5 Region: 211-334
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000129
Family Phosphotyrosine-binding domain (PTB) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B0ET31
Sequence length 1702
Comment (tr|A0A1B0ET31|A0A1B0ET31_LUTLO) Locomotion defects {ECO:0000313|VectorBase:LLOJ001915-PA} KW=Complete proteome; Reference proteome OX=7200 OS=Lutzomyia longipalpis (Sand fly). GN= OC=Psychodidae; Lutzomyia; Lutzomyia.
Sequence
MHRRRKKRPNYGTRTVEVCRGINGFGFTISGQQPCILSCIVNNSPADLAGLRAGDFLINV
NGLNVSKLPHEAVVQLIGNSSGSIRMTIAENYFSDSSDEDPINTHTNVQRVRPKYQNKIK
ANRGLMRRTMEDRNSPSTILSDFALHNLALRQIRENETLLPTSPTGHDIILSPTASDNKD
VRNVSAMVRASNKAREEARAKALAPKMNRLREYRVIVGYLGTVEVPRQISMTGSKLQTVR
GCIRKLRHEKRGFTTVLMTILPNCMTLKNCGDILLATFPAGTINYVSSGSQSDNRFFGII
TSGLYSDGLMCDPTEVILRHTPSHSCHVFAIDTRITDHSWHFEKVNQFKITCSRDPLTNT
CQEVPSTSEYVVNLIRSMYTLKSSGSRQEAGMPFRSKPPLGRGLHMPRSIEHRLNPRALD
DHDFMANSPQPSNHSEITTTSSNSDSGIGFHNDCPNISDRVLVVDFPGIQNHKLIPSFRP
NPIGSSDTSLRSCGLSSAQQEVESLGHNSSIVESIEGKLKPQHSKSKSADNTPRPSTSSD
TDPRLTVESHDLIQKYSVVCPGMILRAMNLSSRICHSNIGFSGKAIDDDGNLVQERPVDV
PTSYGDTANRPFSCDITELEQKRKNFLQMARSCNDIILSFEKEFDRKVNLTKNRPSIQMS
MDDVSVREIESKSPKVPDHDHVFLPPKPVKKPRKMHEGRKSSNMNKIMSYKLSPKVFGLS
RPMSASLENIARTFAKKNSSDTKETSSSIYGSLKDLQNMDLSPRQNLLDSNAYSEPDLRS
NDDARALPTNSGNSPFKRWGQSSFRSRSNEQRNLLPRRPSSLAASESDVYTKSINGDIAT
GRIEGEFSDAGNGTCGGVSGWSNSFERLLEDTAGLHAFAEFLKKEFSAENIYFWTACERY
RQIEDQHERAKEAQEIFAKHLASTAQEPVNVDCQVRNTAEENLQSASIDLFEAAQKQIFN
LMKFDSYARFIRSDLFKSCLEAESKCKPLPYPGDQLDAGLRTGPVVPTPSKLKKSLSNAE
DRRRKSLLPWHRKTRCKSKDRDEANRHLSGGSKSGGSSLRVPLMNSNSDLHSSRSSLSSF
DAAITKLNTNNDSEEGKSTLCRVILPDAATTIVQTRSGETVRELVDRLLEKRGLTYNCYE
AFLAGFSKPLDLEELSRNVAGKEIQIEQRVVFKLDLPNRKVISVKSKPCKFLEDVLRPIL
HKYNYRLEMIQAFGKESPDAINMKIAVTTIDGQRLQIAIKGADGGSNVKQMSKLVTTASI
DGGGNCDVAQLKNTPVMQQQQQHPCMTGNFNQSTLDEITNKVFNELLQGKVETMAGTAGA
AGLENPLSRATVDQLSMKSEEWGSETSSGIFTRARRHELLLKHRGRKMPQSQKNSQTESE
DNADGTKKPLIAKWKSGAKLQVTTRSSPGGDDLLEGLKRAQRSRLEDQRGTEINFELPEF
LRNKENMNNNKSRRESRYDDGGSEVDGIQRRDSNDRVSGFPPRPQPAPRLSIINNNNHAN
CGLSPRTPPPSTSLVGNNNEMATSGGGNYTNSAAIERSLLQLLESSPPQPSGRSDSEKFD
SSPYLTPSRTGFTDPELFYGRHSGDRNAFRHGDLLNSSFSSTTTNNSTHYFEEMGGGFGG
AEMDVQTGGGARGPPPLPPKPKVVPMKPSNWSQSTQRQKQSKMSPTSGIEDVFKMPVEMP
RMSENTRKQKNAYFDQPSSSFV
Download sequence
Identical sequences A0A1B0ET31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]