SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1B0FEN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B0FEN0
Domain Number 1 Region: 800-926
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.76e-36
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 1098-1180
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-21
Family Ras-binding domain, RBD 0.0043
Further Details:      
 
Domain Number 3 Region: 40-122
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-19
Family PDZ domain 0.0074
Further Details:      
 
Domain Number 4 Region: 259-344,371-389
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000316
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 
Domain Number 5 Region: 1041-1109
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000071
Family Ras-binding domain, RBD 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B0FEN0
Sequence length 1481
Comment (tr|A0A1B0FEN0|A0A1B0FEN0_GLOMM) Uncharacterized protein {ECO:0000313|VectorBase:GMOY002065-PA} KW=Complete proteome; Reference proteome OX=37546 OS=Glossina morsitans morsitans (Savannah tsetse fly). GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MHHHHVPQPTKNSMSDPASAAGNVTRAITTQQQRRRKKRPNYGTRTLEVRRGFSGFGFTI
SGQQPCRLSCIVSNSPADQAGLRAGDFLISVNGLNVSKLPHETVVQLIGNSFGSIRMQIA
ENYYSDSSDEENATLQQNPHSLGFHNTSGLRYLHHKTKLHRMRNSPQKKRGETSLKHKSQ
TERGQTKKISKEVSKKHMAESLTLSNLCPLMEDIPLRPLAVMSESIKPCTTPAAVYNSNV
ANVSAMVRVPSNALEYRAVVGYLGTIEMPKQISQSSKLQTVRSCIRKLRQEKRQPSTVLM
IILPDSLHLQAANGTVLATYASSRLSYVSSSSESENRFFGLVTSAVHTTPLDEDNDEQDN
EAPTLSSSITSHITISNSCHVFVVDTKLCEHQLHLERAQDFHIECTKDLISSLCLEFPSN
SEYVVNLIRSMYTMRILPPATQRCNSGDHCVQASGGEAAHSPQPSNHSEMSTTTSNSDSG
IGFHNDCRNISDRIVVVDFPQVNYVPIRSMGMQSSRPAGIFQRLNLEQPSPPVVSTENKR
LSVRALADAVSNPITSINGFMTTRSCDDVLSLLENDEIIAPSYTNHQHVSVDDIPLHNVS
LNGEERKLFLHPSSIERDNSYFLSESLSSNKTRRSKQVPDKLSPQVYDLGISFIKTSKSK
MSPKNSSLSECKPADDPVTMANETSDEINGNRNLQELQQKKALKSVKYSELTSSEPDLCA
STDRKFLSQRRSWVQSSLRTFRSDRNSVNRNEKLSIDNNICPLQRSVSLSENILNNDSVD
KPTKPVPDHRKSEKELNENSRVSSWATSFANLLEDPLGVKTFAEFLRLEYSAENIYFWTA
CERFRHIDNEAERIIQAKIIFSKHLSDIATEPVNVDSQARNAVEKRLRQSADVDVFVVAQ
KQIFNLMKYDSYQRFIRSDLFKKTLQAQERGECLPFEKDNLDDLLKTNFTSDASTNLKKS
ASNAEDRRRKSLLPWHRKMRRKSRDLSEENVRRQTCKNFGLTSKNQRSTFFNDLHGSRSS
LSSYDASMMGSAASLNTNTPLCRVKLPDGSTTIIQIQLEETIGELIKRILEKRGLKYKTF
EVFVRGLTTKSINLQTLSQEIAGKEIEVEQRVAFKLDLPDFKVISVKSKPRKTLYDVMKP
ILQKYNYQLEEVETLYKDTKEKIDLHQHVAEVDGQRLQVLIKSNKIKFVKPLPVKGINAQ
ITLNEMTNTVFKNLMEGKLQSRNLTKSDDSNSLKSNDCDSHTSSIPDRTRRRDSANLINL
KSKKKLHAKAGYDELVPFNRTLANNLKGVNCKLPFNKSVPDKAIENQDELLEGLKRAQLA
RLEDQRGTEINFELPDFLKNKENLLKSLNRNTENTTKNKSRYGTYMGRPQPAPRLSITNK
NRLLSTSDEQASIRCNSEAQPTTSSSKSPPPLPPKPKVLPIKPSNWGVATAHPISPSVTT
AAGPQLFNKLSKTTEMVTGAAISKVALIAAAYLEEPSSSFV
Download sequence
Identical sequences A0A1B0FEN0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]