SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1B1KJR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1KJR1
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.58e-39
Family Frataxin-like 0.00000692
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B1KJR1
Sequence length 106
Comment (tr|A0A1B1KJR1|A0A1B1KJR1_SERPL) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} KW=Complete proteome; Reference proteome OX=1154756 OS=Serratia plymuthica PRI-2C. GN=Q5A_000790 OC=Yersiniaceae; Serratia.
Sequence
MNDSEFHQLADQLMLNIEETLDDFDGDADIDYETNGGVMTLSFENGTKIVINRQEPLHQV
WLATKTGGYHFNYRDGAWFCDRSDRGFYPLLSEAASAQAGEDVHFA
Download sequence
Identical sequences A0A1B1KJR1
gi|333929986|ref|YP_004503564.1| gi|386326857|ref|YP_006023027.1| WP_006318320.1.100617 WP_006318320.1.22336 WP_006318320.1.28294 WP_006318320.1.55341 WP_006318320.1.72308 WP_006318320.1.85867 WP_006318320.1.87098 WP_006318320.1.91790 WP_006318320.1.95373 gi|333925033|ref|YP_004498612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]