SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1B6DR03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6DR03
Domain Number 1 Region: 617-739
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.15e-38
Family Regulator of G-protein signaling, RGS 0.0000816
Further Details:      
 
Domain Number 2 Region: 885-969
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.42e-23
Family Ras-binding domain, RBD 0.0027
Further Details:      
 
Domain Number 3 Region: 7-93
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-20
Family PDZ domain 0.0086
Further Details:      
 
Domain Number 4 Region: 207-319
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000384
Family Phosphotyrosine-binding domain (PTB) 0.0068
Further Details:      
 
Domain Number 5 Region: 829-897
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000804
Family Ubiquitin-related 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B6DR03
Sequence length 1293
Comment (tr|A0A1B6DR03|A0A1B6DR03_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS28107.1} OX=38151 OS=Clastoptera arizonana (Arizona spittle bug). GN=g.8853 OC=Cercopoidea; Clastopteridae; Clastoptera.
Sequence
MHPVRRRKKRPNYGVRTVEVSRGKNGFGFTISGQQPCILSCIVPGSPAESAGLRAGDYLV
AVEGQSVSKVPHDDVVRLIGCSSGVLKLQIAENYYSDSSDDDAVVTARQKPKYPHKLRSN
VQNSRSTVVTTQSRAAKVVRDLRTGAMFEEQPAVPAVSVIPVSPPRSVKLLPDLNIQHWK
PPNHLPAPLSRLFLPGPSNQPQEINEQVYQAVVGYLGTIEMPRKLPAGSRLQILRGCIKR
LRTEKRTHTAVLMTILTQSLRLTNGSGQTLAVYPADRVTFCGTSSEEDKRHFGIVTTATG
DDPSSSCHVFAVDPRSHSDHLTRAKTFKIECHIDPSTGYCKEFPLNCEPIIILIRSFYEA
GVRSNNDSDEPVMANSPQPSNDSTTTTSNSDSGIGFRDDCGNQSDRILVVDVQNQRLHIQ
QIGDSEASTRRISTIKCNGTERLTVRAMPDPVVTSTSSRSRSPLSSCSEGTGIPNENMSI
SSDANKSPDITMIAYDNKLTQSPEEKQTNSVFSNVDKHGSRSIDDMSVESLKSQDALILS
YKLSPKVFGVPQLQFSPTSHSLEDLKLTEKNLESNSANLNKSQQHWGSLQDLRSFVSDCF
ENSTTTQELHEDTEQGVSCWASSFEKLLEDPTGLQTFAEFLKKEFSHENIYFWVACERYR
WLEDITARRQAGQEIFEKHLAIGAVEPVNVDSQARQVTQEELAEAQSTLFLQAQKQIFNL
MKFDSYPRFIKSELYKECLLREISGEALPLPDKLDSGLQLHRNSPLHKCHTKLKKSRSDA
EDRRRKTLLPWSRKSRCKSRDHSASNQDDSESVCSSRSSLASWDLTSSSLCRVILPDGAT
AVVQIKPPQTVRQLILRLLEKRALRYTNFQVLISGLNKVVALDEDATTLGGQEVRVEDRV
IFKLDLPNRKTIAVKSKQSKTLAQVLRPILHKYGYKLEMVTLCLMSENEVLEPSLPVSAV
DNQRLQVLTRSTPTECIHLGWRVSDCGINHSKIKSPPSLDEITNKVFEELLQGKGDTLHP
APSDQGSVRSEDWGSEHSSSFLGRFLRRDSVIMDKQRDYRLKNKKHSSKNTVGEEGIGRI
KPGLSKLPPIIAKWKPGGKLEGRSESDVLYEGLKRAQRSRLEDQRGTEINFELPDFLKDK
ENAPQSGKKIRKIRIDNESTGNSKFYQSAGSSVMTSSQESIGTSAITSSQESLGTSAITR
FMDHSFSTNGIMPSVDKGDEYFLGHTTTNDSSLVNPPQRLHIDPPPPLPPKPKHLPPAAS
WVPLTPANNPQDKNRPCRIRRAVYLDQPSSSFV
Download sequence
Identical sequences A0A1B6DR03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]