SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1B6M1F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6M1F9
Domain Number 1 Region: 616-745
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-39
Family Regulator of G-protein signaling, RGS 0.0000956
Further Details:      
 
Domain Number 2 Region: 882-967
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.69e-21
Family Ras-binding domain, RBD 0.0027
Further Details:      
 
Domain Number 3 Region: 9-93
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-20
Family PDZ domain 0.0078
Further Details:      
 
Domain Number 4 Region: 215-320
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000507
Family Phosphotyrosine-binding domain (PTB) 0.0075
Further Details:      
 
Domain Number 5 Region: 827-894
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000354
Family Ubiquitin-related 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B6M1F9
Sequence length 1235
Comment (tr|A0A1B6M1F9|A0A1B6M1F9_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAT29755.1} OX=36148 OS=Graphocephala atropunctata. GN=g.15197 OC=Membracoidea; Cicadellidae; Cicadellinae; Cicadellini; Graphocephala.
Sequence
MHPIRRRKKRPNYGVRTVELSRGKNGFGFTISGQQPCILSCIVAGSPAENAGLRAGDYLV
AVEGQSVSKVPHDDVVRLIGASSGILKLQIAENYYSDSSDDDVVVTARQKPKYPHKPRNN
ANNARSAALTQQSRAAKVVRDLRTGAMFEEQVVVPEETKPISPLRGIKLMPDLNLHQWKP
PCHLAAPLARIILPSTSNDLANQPVVEEPIYQAIIGYLGTIEMPRKLPPGSRLQIVRGCI
KRLRAEKRSHTAVLMSVFNQSLKLTNGSGQTLAVYPADRVTFCGASSEEDRRHFGIVTTS
ADEDPSNSCHVFAVDPRPHAEHQQRAQTFKVECNVEPSTGQCREFPQNCDPIITPIKVFY
ESGMRQNDIDEPVMANSPQPSNDSTTTTSNSDSGIGFRDDCGNQSDRILVVDVQNQRLHI
QQIDESDQPTHRVSTVQCTKRLTVRAMPDPVVPGGGGGCNRSQSPLSTSSDSPGVANENM
SVSSGATKSPDVTMLLFDGNKNSTVIENTNNTMVFNGMEVNGNRSADDMSLGSARSQDAL
LMSYKLSPKVFNVPNMQPPPTSHSLEDLKVTEQSRETSAVSMKLSQFGSLQELRSFVSDC
FESSAAVQNSHEDPDQGVSCWASSFEKLLEDPDGLQTFAEFLKKEFSHENIYFWVACERY
RWLEGEDARREAAHQIFEKHLAVGASEPVNVDSQARQVSADELNQAQPTLFLQAQKQIFN
LMKFDSYPRFIKSELYKECLLREISGEALPLQGKLDSGLQLHQNTPLHQTHSKLKKSRSD
AEERRRKSLLPWSRKARCKSRDRSDAESVSSSRSSLASWDLALSPALCRVVLPDGATAVV
QIRPPQTVGQLVVRLLDKRGLRYANFQVFIGHSSKAVPLDEDAAVLGAQEVRVEDRVVFR
LDLPNRKTVAVKSRQGKTLAQVLRPILHKYGYRLEMVTLCLMSENEVVEPTAPVTAVDNQ
RLQVLTRSTPTECSHLGWRVGDCHGKVKSAPTLDEITNRVFEELLRGKADNLTQASDQGS
VRSDDWGSEHSSGILGRFIRRDSAFLEKHREGRHKAKKGAKYGSNGADESRAKPALSKLP
PLIAKWKPTVKLDGRSESDVLYEGLKRAQRSRLEDQRGTEINFELPDFLKDKENAPQSGK
KVRKTTSKFYQTAELSQASSQESLRFVDQSFSNDGIVPTTEAAEEYFLGTESVQTPPPLP
PKPKHLPPSTSWPPQSRPGRTRRAVYLDQPSSSFV
Download sequence
Identical sequences A0A1B6M1F9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]