SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B7WIR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B7WIR3
Domain Number 1 Region: 1-31
Classification Level Classification E-value
Superfamily Subunit XII of photosystem I reaction centre, PsaM 0.0000000000248
Family Subunit XII of photosystem I reaction centre, PsaM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B7WIR3
Sequence length 31
Comment (tr|A0A1B7WIR3|A0A1B7WIR3_9NOST) PSI-M {ECO:0000256|HAMAP-Rule:MF_00828} KW=Complete proteome OX=1710886 OS=Anabaena sp. MDT14b. GN=AN485_10205 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MPISDTQVYIALAVALIPGILAWRLATELYK
Download sequence
Identical sequences A0A161VRZ0 A0A1B7UZE9 A0A1B7WIR3 A0A218Q7A6 D7E5I3 K7WW20 K9WVI5
gi|414077301|ref|YP_006996619.1| WP_006196319.1.17284 WP_006196319.1.18086 WP_006196319.1.25658 WP_006196319.1.44637 WP_006196319.1.47433 WP_006196319.1.50365 WP_006196319.1.60463 WP_006196319.1.65595 WP_006196319.1.6664 WP_006196319.1.76008 WP_006196319.1.7687 WP_006196319.1.86392 WP_006196319.1.87691 gi|434404190|ref|YP_007147075.1| gi|298492489|ref|YP_003722666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]