SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1B8NX36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B8NX36
Domain Number 1 Region: 2-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.64e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B8NX36
Sequence length 316
Comment (tr|A0A1B8NX36|A0A1B8NX36_HALEL) Thioredoxin reductase {ECO:0000256|RuleBase:RU003881} KW=Complete proteome; Reference proteome OX=2746 OS=Halomonas elongata. GN=A8U91_03633 OC=Halomonadaceae; Halomonas.
Sequence
MSEARHERLIILGSGPAGYTAAVYAARANLKPLLITGIQAGGQLTTTTDVDNWPGDDIGV
QGPELMERMKRHAERFETEVLFDHVHEVELRERPFTLKGDNGTYTCDALIIATGASARYL
GLESESRFMGQGVSACATCDGFFYRNQDVVVVGGGNTAVEEALYLSNIASKVTLVHRRDS
LRAEKILQDKLFDKVENGNIEVIWNHTLDEVLGDNTGVTGARLKSTEDGSTRELDAPGVF
IAIGHSPNTGIFEGQLDMAGGYIKVQSGLEGNATATSVPGVFAAGDVMDHVYRQAVTSAG
SGCMAALDAERYLDEL
Download sequence
Identical sequences A0A1B8NX36 E1V926
WP_013333570.1.66923 gi|307546404|ref|YP_003898883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]