SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B9NZ46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B9NZ46
Domain Number 1 Region: 92-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000157
Family NfeD domain-like 0.0051
Further Details:      
 
Weak hits

Sequence:  A0A1B9NZ46
Domain Number - Region: 28-75
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0523
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B9NZ46
Sequence length 150
Comment (tr|A0A1B9NZ46|A0A1B9NZ46_ALILO) Uncharacterized protein {ECO:0000313|EMBL:OCH21275.1} KW=Complete proteome OX=688 OS=Aliivibrio logei (Vibrio logei). GN=A6E04_12080 OC=Vibrionaceae; Aliivibrio.
Sequence
MEFFEQMNHWHWLTLGLLLLAGELLGTAGYFLWIGLSAVTVGILYSFIPMSWQLQWVSFS
VFSLFSTWLWWRYQHKKDIKSDSTRQLNQKDKQLLGQITRLDDDVLAGNCRIKLGDTTWS
AKSFENISKGTMVCVVSVDGIILTIEPVKD
Download sequence
Identical sequences A0A1B9NZ46 B6EQQ7
gi|209809087|ref|YP_002264625.1| 316275.VSAL_II0281 WP_012551643.1.33597 WP_012551643.1.35969 WP_012551643.1.50441 WP_012551643.1.77666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]