SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1C5GYQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C5GYQ8
Domain Number 1 Region: 9-299
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-75
Family Protein kinases, catalytic subunit 0.0000000185
Further Details:      
 
Domain Number 2 Region: 437-496
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000392
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0062
Further Details:      
 
Domain Number 3 Region: 503-564
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000719
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C5GYQ8
Sequence length 605
Comment (tr|A0A1C5GYQ8|A0A1C5GYQ8_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:SCG38291.1} KW=Complete proteome; Reference proteome OX=299152 OS=Micromonospora siamensis. GN=GA0074704_0652 OC=Micromonospora.
Sequence
MTAQARLLGGRYQVGELLGYGGMAEVHRGRDLRLGRDVAIKMLRADLARDATFQMRFRRE
AQNAASLNHPAIVAVYDTGEETGPTGETLPFIVMEFVNGRTLKEVLGVEGRLQPRRALEI
CADMCAALEFSHRHGIIHRDVKPGNVMLTQTGQVKVMDFGIARALASGATTMTQTSAVIG
TAQYLSPEQARGEAVDARSDVYAAGCVLFELLCAHPPFVGDSPVSVAYQHVREAPPTPSD
INPDVNPAVDAIVLKALSKNPLNRYQSAGEMRADLLRAAAGRPVMATPVMSHEEATQLAP
AATTAAYPAAAGAPTRQQVPARVGDPRQRKASSWVMAVLAAVVVLSLIALGAAWLNGRNK
DDGAEQPKLVAVPSVVDQPQDAAIAQIRGAGLTPKVAEDLRYGTCEKGTVVSQAPTGGQL
EPNQEVTLTICGGIAQVEVPDLKGFTYEAAVKQLKDSKLKPEKQEVNSGEREGTVIDVSP
KPGTQVGEGATVTLQVSKGNVNKVPNVVGLDQDEAERTLKNAGFEPEVELGADVPADQAG
KVTAQTPEGNTRKPEGTKVVITVSQPEPTTEPTPTDQPTASPEPTPSATATGGGGGFPFP
TPPPQ
Download sequence
Identical sequences A0A1C5GYQ8
WP_088969110.1.65141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]