SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1C5PHZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C5PHZ1
Domain Number 1 Region: 9-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-80
Family Protein kinases, catalytic subunit 0.00000175
Further Details:      
 
Domain Number 2 Region: 405-468
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0054
Further Details:      
 
Domain Number 3 Region: 476-536
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000523
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C5PHZ1
Sequence length 696
Comment (tr|A0A1C5PHZ1|A0A1C5PHZ1_9CLOT) Serine/threonine-protein kinase PrkC {ECO:0000313|EMBL:SCH36818.1} OX=59620 OS=uncultured Clostridium sp. GN=SAMEA3545337_01225 OC=Clostridium; environmental samples.
Sequence
MLKEGVFLGKRYEILGRIGSGGMADVYKGKDHKLNRYVAVKVLKSDYRNDESFIKKFVSE
AQAAAGLMHPNVVNVYDVGQDRGLYYMVMELVEGITLKEYIEKKERLSAKEAISISIQMI
SGIQAAHNHHIIHRDIKPQNIIISKDGKVKVTDFGIARATTSTATISTNVMGSVHYTSPE
QAKGGIVDERSDIYSAGITMYEMVTGHVPFDGDSTVSVALKHLKEKIVAPSVEVPDIPYS
LDCIIMKCTEKNVERRYQNCQALISDLKHSLVDPDGHFVDEQLDVFTGRKPAGDETILMS
EDEIRRAQERSYSQSDDYDDSDYDDDDYDDDDYDDDDDDYRAPTQRRNSDYNRKKNVDPN
TKKIMKILMIVAAAIIAMVIIFMVGNAMGAFKGGIGLNTTTNDAKVVVPNLLGMTEDEAK
AALKKKNLGYSIAGREESDKYAAGEIMEQSEKANSKVEKNTEIKVVISTGKAKKTVSVPD
VKGMSEDDAQKTLENLNLVVEAQAQNNDTVASGKVISTDPAVGTQLTEGSKVTMYVSLGI
ESVEVPSITGMSSEEAQSAIQNVGLQASVTEDYSDTVASGMVISQDPASGKVKKGSTVNI
VVSKGAKVKMVTVPSLSGMTQQAAEQAIIDAGLTVGSVTEEYNAGVSAGYVISQTASVGS
QIEKGSSVGFVVSKGAQPSTDNGNTGGEDNESSELQ
Download sequence
Identical sequences A0A1C5PHZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]