SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1C5RY30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C5RY30
Domain Number 1 Region: 9-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-83
Family Protein kinases, catalytic subunit 0.00000113
Further Details:      
 
Domain Number 2 Region: 447-507
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000798
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 515-576
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000314
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1C5RY30
Sequence length 833
Comment (tr|A0A1C5RY30|A0A1C5RY30_9CLOT) Serine/threonine-protein kinase PrkC {ECO:0000313|EMBL:SCH66396.1} OX=59620 OS=uncultured Clostridium sp. GN=SAMEA3545340_01159 OC=Clostridium; environmental samples.
Sequence
MVRIGMFLGDRYEILEKIGSGGMAEVFKGKDHKLNRFVAVKVLKDEFVEDKNFVRKFKEE
AQAAAALAHPNIVNVYDVGDEQNIFYIVMELVEGITLKTYIEKKGRLTVKEATSIAIQVA
SGLEIAHNNQIVHRDIKPQNIIISREGKVKVTDFGIAKSISSNTNTADAMGSVHYTSPEQ
ARGGYSDAKSDIYSLGIVMYEMVTGRVPFDGETTVVVAVKHLQEDIVSPRVYASDVPVSL
EHIILKCTEKSPDRRYASAAELIADLKQSLLTPDVNFVKEIVPDGAKTVAITRDEISKIK
RETGRIPAASDDAESKYAYLDRLNAEKDEEYDDEEYEDDEDDDYEDDDYEDDDYDEDEGR
GKKGGLFGFLKKEKKDEDDGDEEDDDDSDGGILDPKMEKIMTIGGIVAAIIIVIILAVII
GKVLGFGKGSSDKTTDDTEIADVLNEEVEVPNLLGKSYSEAKEELNKLGLGITLGETKSS
DQYEAGQIVSQSEEEGTKVDPNTTIVVDVCGDGEKVEVPDVKGYTEAKAKSALEALGLSV
DISEVTSEDVAEGKVISTSPAAGKKIDKSSVVTVVVSKGKEANQQVEVPTITGKTESKAK
ELLKAAGLASGQASQEYSDTVDEGNIISQSPSAGTKVDKNTKVSYVISKGKNTVHVGDYR
GYTKSEIESKLDGKGLKVSYTDSQYSDKYDKGTVVTHSPMDADVAAGSTISVTLSEGPEP
AKTANVPGSGDSVNEITNRGFTVGNITKEYSDTVAEGKIISCSPSGAQNLGTKIDVVVSL
GVCTHPNVDANGKCSQCGKTGLTPTVTPSPSADPSPSAGDGTTQSAGSGGQAQ
Download sequence
Identical sequences A0A1C5RY30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]