SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1C6HWQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1C6HWQ8
Domain Number 1 Region: 8-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-82
Family Protein kinases, catalytic subunit 0.00000157
Further Details:      
 
Domain Number 2 Region: 544-605
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.008
Further Details:      
 
Domain Number 3 Region: 476-535
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000837
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1C6HWQ8
Sequence length 716
Comment (tr|A0A1C6HWQ8|A0A1C6HWQ8_9FIRM) Serine/threonine-protein kinase PrkC {ECO:0000313|EMBL:SCJ62352.1} OX=765821 OS=uncultured Blautia sp. GN=SAMEA3545380_02560 OC=Blautia; environmental samples.
Sequence
MLKEGMIVGERYEIISRIGSGGMADVYKAKDHKLNRLVAVKVMKAEFSQDKGFISKFRKE
AQAAAGLAHPNVVNVYDVGEDNGIYYIVMELVQGITLKDYITRKGKLSVREATSIAIQVS
LGLEAAHKSNIVHRDVKPQNIIISVDGKVKLSDFGIARAASSNTISSNVMGSVHYSSPEQ
VRGGYSDAKSDIYSLGITMYEMVTGHVPFDGDTTVAIAIKHLQEEIVSPRKYVPDLPYSL
EQIILKCTQKSVDRRYENMSEVIEDLKHSLLDPNGNFVVVTPLAQHAQTVMLSNDELEAI
REGRSGYATPQKDTYEEEEDDDEEEYDDEYDDDEEDDDDEDGEVSSKLEKAMTIGGFIIG
AIIICILIFFIARAAGLVNIGGTAKKDDTQQTEQEEIDDTVDENGQVSVPKLTSMTEENA
LSVLEQLGLKGNKTGESQSSEYKAGTIMSQETEAGTKVDQGTVINYVVSSGTDAPSVPSV
TGKSQSEAEALIKALGLNTEIQQDYSDTVAIGKVISVNPSEGTKVDAGSTITLVVSLGEE
NKQVEVPNVIGQDEATAKKSLNDQGLQVNVETTTDASGNVAEGCVANQSVAAGTSVDPGS
TITLQVYHAPETTTLPNEAPAEGDASDSDTGSWTCNVKLDQPSTYTGGPVQLTLVQNVNG
QNVETVILDGQTITFPYTLAIAGADGVDTGTVYLREMVDGDYVERGHYSNVPFKQS
Download sequence
Identical sequences A0A1C6HWQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]