SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1D2MIX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D2MIX3
Domain Number 1 Region: 770-898
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-33
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 34-119
Classification Level Classification E-value
Superfamily PDZ domain-like 2e-19
Family PDZ domain 0.0091
Further Details:      
 
Domain Number 3 Region: 321-448
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000174
Family Phosphotyrosine-binding domain (PTB) 0.0057
Further Details:      
 
Domain Number 4 Region: 1046-1136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000194
Family Ras-binding domain, RBD 0.0039
Further Details:      
 
Domain Number 5 Region: 985-1053
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000543
Family Ras-binding domain, RBD 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D2MIX3
Sequence length 1284
Comment (tr|A0A1D2MIX3|A0A1D2MIX3_ORCCI) Regulator of G-protein signaling loco {ECO:0000313|EMBL:ODM92977.1} KW=Complete proteome; Reference proteome OX=48709 OS=Orchesella cincta (Springtail). GN=Ocin01_13704 OC=Orchesella.
Sequence
MDIPSSPSPVPQHGMRRRKKRSTPTNTVPGSSLTGLNRGSIRIVELIRGSLGYGFTISGQ
KPCLLRCIVEGSPADRAGLRPGNCLVGVNNKDVSHLAHDDVVSIIGSCTGLLRLHVADSY
FSESSDDECFQQVQQARPKYPHRPRPVKTVTTSKKLPTYTKMPSMDIASEEKIPIKSIQC
PKSPESLHRSTSPSARRASWDPLMPSPRRIPRPPYLCDEESPIPAIPPRSQNVPSTSYQK
TVNPNVEIIRVFGHLESPSGSSCSSSSKMTPITKLVTAPLFSPASTSNDRFNTHSSSGSS
SRRENANIRKPGNHTVRQIPDPSETSESNYQAVVGYIGSVEIPEVHENKRLQAISACVKK
LRQEKRVRSIVLLRIQSNGISLFSSNQNVQNGPPLAFYSSSIIAFCGAYGDDRRFFGLVT
STGSRKNYSCHVFMVEPKLLSHLEHTRRARCFGIQCTALSVPKSGQVLGLQECAEFPATA
DSILNSILRLHRASDEITPRSPSEASTRLESTNSSNSDSGIGFRDDCDRNSAQIYDILEH
DTNSELKPPCRSPQLRRHTSPNLRKSLPSVGSYALSTHDCVMQMQSRCASKEPGKVRVPS
TSYQHAELFGHSSFDSDPKSLQEILCTSADRVRGAREMPSTSKAIGHSSRDRLSLDGSNR
QPPPPIEVSVLVTPTRGREKRQSMDRMTPVVDEDFSKSNPNRASRASIARHGTRSLENLC
IPDDEVPNPLECRNSIGSSTPALNQDLKNSSSGVEWEFKVPKPPKPKMDGNRAKKWAESI
EKLLSDPGGSQVFTEFLQHEFSAENIHFYTECLMFKEAFPSLTQSQRISTASTIFQKYLQ
NGATDPVNVDFQARCQCEKALYQPTQDMFDSTLAQVFNLLKFDCYPRFLRSDIFRDYSSG
TLALPPLPGEQSDSDQESVKSRKLSLDGRRRSLLPWNIKNRSKKSKAKGDPDGLNSDLSF
IQQAALNPSCDGSDQDDGFRRQSYKICRVVLPDNSTTVVPCIPGETLGAVVQKLLKKREF
HYSAFEVVSASSGKTLDVNMQVTDMTTREIKVEPRAFIGIELPHGWKVGVRANPNRKVAE
VLKPILSQHSLKLDAVVVYDLETCEILDTKCPMGKLDSHNLLVKSKAEAKLEEITNHIRE
FGTFDHPFVDDDQISAKTSSSQASSVFRDFLRRSSKKYKRKNKGGCQYNSLEDPAKDPAN
ELHGGLRSDIESEPERAPTPLTKLSDEENSLPPQYLASSHPHLSVVKSTPESPLSLVPSE
LNLAENSRNRKPIYISQTTNSKES
Download sequence
Identical sequences A0A1D2MIX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]