SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1D5PY26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5PY26
Domain Number 1 Region: 684-830
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.03e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1014-1114
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.42e-30
Family Ras-binding domain, RBD 0.00088
Further Details:      
 
Domain Number 3 Region: 220-368
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-22
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 
Domain Number 4 Region: 8-99
Classification Level Classification E-value
Superfamily PDZ domain-like 8.92e-20
Family PDZ domain 0.011
Further Details:      
 
Domain Number 5 Region: 959-1028
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000956
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D5PY26
Sequence length 1395
Comment (tr|A0A1D5PY26|A0A1D5PY26_CHICK) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSGALP00000057875} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=RGS12 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MYRPGETVKRRLNMHAPPRIRSVEVARGRAGYGFTLSGQAPCILSCVMKGSPADYVGLKA
GDQIFAINEINVKKASHEDVVKLIGKCSGVLHMVIAEGISHIDSCSSDEEVGFYDGKGWL
KPKPDSKALGINRAEKVVEEMQSGGIFNMIFESPNLCAGNTDNCAPKQRSFSDSAAIKFE
TGNESLSNPNLLSKDELSKVLNDDSVFRVGLESAEDFGLDASILNVAMIVGYLGSIELPS
TTSNLENESLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDASLAQEDEGVLRTSCHVFMVDPELFHHKIHQGIARRFGLE
CTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADVHQNNSTSSNS
DSGIGNFNQEEKNNRVLVVDLGSNPSKHIPSSIWENPVGRGQNQSAAHWNGFCHEQEGNI
PLEVIQNDKSQNLNKHLSPSARIEVPLVSSRNSVPPSKKSAAGVGNQRWLPVHVLQEWQH
GNASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVDGSFGQPQLKSHKNEWSKKMFC
MQNKFGLPHSVRKSKEDKKGAKFGRPMGLNQAPPQRSSVRRSFGRSKRFSITRSLDDLES
ATVSDGELNSADLKDCISENSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVK
YFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRTLPDPQRV
PSSPTSKHSISSEKSNISTPKKLSGKSKSGRSLNEESGEEDTEKKKRGTFFSWSRSKSLG
KSQKRKENGDYPNGEYSIQSNGLSYRRESQGSMSSTASLDLSEASRLPAFVPDKEKSPKY
CSVNLPDGSSSKMAVKSGFSIKEVLSGLCEKHGINIAAVDLFLVGGDKPLVLHQDSSILE
SRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNELVARLNGEQE
PLDLGIPISNLDGQRVILDEKEPTKGRVFTDKQKGASVKQSATVTTSRNQVSTGEGRTLG
KSNSIKMKGENGKNAREVRLSKREESIAKIGKKKCQKINLDEAEEFFELISKAQSNRADD
QRGLLRKEDLILPDFLRLPPTGPEPSSSTPTGPKGLSRQASKNDEKDGCTSPSGKQEPIQ
NYNENSVKKMAYSENKHKAALTALHSQKSFSVPFNTTLSPIPHAHENSATIWKRQSRELQ
AEGIQMIDDENVADLTLVAEGDISSPNSTLLPPSPPPQPSDVSKLTEANYPPPTPFAGNQ
EKSGYQRSNSGISRF
Download sequence
Identical sequences A0A1D5PY26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]