SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1D5RCW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D5RCW5
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily CBS-domain pair 7.58e-22
Family CBS-domain pair 0.00000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1D5RCW5
Sequence length 118
Comment (tr|A0A1D5RCW5|A0A1D5RCW5_MACMU) Protein kinase AMP-activated non-catalytic subunit gamma 2 {ECO:0000313|Ensembl:ENSMMUP00000058158} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=PRKAG2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVYS
LIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFVHQEDGINYTLYKRCLICQSLPS
Download sequence
Identical sequences A0A1D5RCW5 A0A2J8JZF2 A0A2J8RKN3 F8WDB5
ENSP00000420645 ENSP00000420645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]