SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1D6DTG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D6DTG4
Domain Number 1 Region: 302-400
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-17
Family B3 DNA binding domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D6DTG4
Sequence length 439
Comment (tr|A0A1D6DTG4|A0A1D6DTG4_MAIZE) B3 domain-containing transcription factor LEC2 {ECO:0000313|EMBL:ONM12153.1} KW=Complete proteome; Reference proteome OX=4577 OS=Zea mays (Maize). GN=ZEAMMB73_Zm00001d001838 OC=Zea.
Sequence
MANANGSSTGAGHSDLVRAISHEQHQAFMASVPRAAPGGVNVHHQQHFHQYPAGLIPAPV
ALPVHAPVSSQTSPYSAQIAVPPPPPPLIASPDHRLHSLPPTGCYQLDYSPYGNAAAPSQ
QHTSAIRGFADWGTHSNALMSLAHATSFGNNGSSNINNNGLLHQNLSPYTTHTWTTTYVQ
RPYNTAVYAPATMNMLQTPPFHSNSHEKESGAVFSNSFNMAPSVTPTSPFQLMSPSSTNY
TSTQIFEETNNLEDTSRVFGGGDNESNNSEEPDPKPAVEMEDLNQGNDHTSNKTANCQDY
RMVLRKDLTNSDVGNIGRIVLPKKDAEPNLPILEDKDGLILEMDDFELPVVWNFKYRYWP
NNKSRMYILESTGEFVKRHGLQAKDILIIYRNKKSGRYVARAVKAEDIAPPECECVEAGN
PREECGFSVSPSINKKIIT
Download sequence
Identical sequences A0A1D6DTG4
GRMZM2G149940_T01|PACid:20842517 GRMZM2G149940_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]