SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1D8SRH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1D8SRH8
Domain Number 1 Region: 7-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-77
Family Protein kinases, catalytic subunit 0.0000000449
Further Details:      
 
Domain Number 2 Region: 450-508
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000353
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 514-576
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000968
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1D8SRH8
Sequence length 671
Comment (tr|A0A1D8SRH8|A0A1D8SRH8_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:AOW87966.1} KW=Complete proteome; Reference proteome OX=68249 OS=Streptomyces pactum. GN=BC342_17080 OC=Streptomyces.
Sequence
MEEPRRLGGRYELGPVLGRGGMAEVYHAHDTRLGRQVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYIDNVSIPFIVMEYVDGSTLRELLHSGRKLLPERTLEMTI
GILQALEYSHRAGIVHRDIKPANVMLTRNGQVKVMDFGIARAMGDSGMTMTQTAAVIGTA
QYLSPEQAKGEQVDARSDLYSTGCLLYELLTVRPPFVGDSPVAVAYQHVREEPQAPSVFD
PEITPEMDAIVLKALVKDPDYRYQSADEMRIDIEACLDGQPVAATAAMGAMAAGGYGAYP
DEQPTTALRSDAGGGATTMLPPTNPDDGGYGYDDRPDRRRQQPRKKNTSTIFLVLAGILV
LVGAILIGKYAFTGNGGAGNDKIPVPTFVGLSKGDAQQQAGNVDLELTFKEQPCEDQPKG
NVCEQDPKQGTEVDKKTTVNLVVSTGAPKVAVPNVIDENVDDATQELKDKGFEVDTKQTE
SSQDEGTVLSQDPDPGTEKEKGSTVTLEVAKAEEKATVPDVVGRSCDDAKSQMESNGLEA
TCTDQPTNDANQVDKVISTTPSANQQVDPGSKVTIVVGKAVEKTKVPEVRTKTLAEARQI
LQQSGFTNVQVQPGAPTEDNTTVIAMDPQPGTEVDDPGAQQITLTTIAGNNGNNGGNGGD
GGGFIGGFGRD
Download sequence
Identical sequences A0A1D8SRH8
WP_070388579.1.11327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]