SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E1J5A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E1J5A8
Domain Number 1 Region: 66-142
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 2.44e-19
Family Ribosomal protein S15 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E1J5A8
Sequence length 151
Comment (tr|A0A1E1J5A8|A0A1E1J5A8_LEIGU) 40S ribosomal protein S13, putative {ECO:0000313|EMBL:CCM18771.1} OX=5670 OS=Leishmania guyanensis. GN=BN36_3362570 OC=Leishmaniinae; Leishmania; Leishmania guyanensis species complex.
Sequence
MVRMHGNGRGKASSALPYRRTPPAWLKIASRNVVKMVCKSSRKGMMPSQIGMELRDSMGI
AQVKNVTGRKILRILKHNGLAPEIPEDLYFLVKRATQMRKHLERHTTDRDTKYRLILVES
RIHRLARYYKRVKQLPPTWKYESSTASAMVA
Download sequence
Identical sequences A0A088S041 A0A1E1J5A8 A4H9Z7 Q4Q3M1
psu|LbrM19_V2.0710 psu|LbrM33_V2.3420 XP_001564167.1.15230 XP_001568106.1.15230 XP_001682616.1.98313 XP_001686077.1.98313 XP_010698032.1.42505 XP_010702414.1.42505 gi|154335862|ref|XP_001564167.1| gi|154344324|ref|XP_001568106.1| gi|157868126|ref|XP_001682616.1| gi|157875365|ref|XP_001686077.1| gi|68126071|emb|CAJ07124.1| gi|68129150|emb|CAJ06877.1| psu|LmjF19.0390 psu|LmjF33.3150 5t2a_AG

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]