SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E3NKV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3NKV5
Domain Number 1 Region: 14-416
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.7e-88
Family IF2B-like 0.0000000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E3NKV5
Sequence length 425
Comment (tr|A0A1E3NKV5|A0A1E3NKV5_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:ODQ46750.1} KW=Complete proteome; Reference proteome OX=763406 OS=Pichia membranifaciens NRRL Y-2026. GN=PICMEDRAFT_11726 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MSLQAIKFSATPEVSLSILNQLQVPYQSKYIAIDSIAPLPGVTKFSGYEAIKGMYTRGAP
AIMLVGCFSIVVELNRVLHSDIGSAQQYKYNLNDAESFKRRLLERIDELIKSRPTAVNLA
NGCEEIKKIVVSEKNSDLELLYNRILQFSENLYKEDYQSNINIGKNGLQYIKDVLKKENF
KGPFSVMTICNTGSLATSGYGTALGIIRHLHQYLSKDKSTDQFYFEHAYPCETRPYNQGS
RLTAYELQYEKIPFTLITDNMPSFLIDNLNRKEQHTNQGALASLASNAPIRFIIVGSDRI
VKNGDLANKIGTFQLSLLSKLYDEIKFIGAAPTTTIDYNTKSGEDIKIEERPKDELTMVL
GAKMNGNSFAEDKESKDVVLERVRMAPLDIGVWNPSFDVTPHQNIDCIVTEKEYLVKDSS
GVFHL
Download sequence
Identical sequences A0A1E3NKV5
XP_019017863.1.70258 jgi|Picme1|80943|CEP25523_3169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]