SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E7XQG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E7XQG5
Domain Number 1 Region: 3-271
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 8.04e-92
Family Methylenetetrahydrofolate reductase 0.000000904
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E7XQG5
Sequence length 272
Comment (tr|A0A1E7XQG5|A0A1E7XQG5_9PROT) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome OX=160808 OS=Acidithiobacillus ferrivorans. GN=A4U49_13355 OC=Acidithiobacillaceae; Acidithiobacillus.
Sequence
MAHSVEFFPPKNAAGEERLREAISALLPLGPEYASVTFGAGGSTRERTFVTVAMIRQDYD
LEAVPHLSCIGSTEAGIREILEDYQKQGIRRIVALRGDLPEGMENPGHFQHAADLVAFIR
HFGGFDVYVAGYPEIHPRATSARDDVAHLVTKVQAGADAIITQYFFNPDAYLQLRDDLQR
QGVDVPVVVGVMPITNFEQISRFSAMCGADIPQYVRRRMEAYADDPQSQYQLGIELLSRQ
CQLLLREGAPSLHFYTLNQAEATVAIWRNLSL
Download sequence
Identical sequences A0A1E7XQG5 G0JN37
gi|344199142|ref|YP_004783468.1| WP_014028401.1.78061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]